KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_0210Help
Entry
spyM18_0210       CDS       T00079                                 

Gene name
hasC2
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    spyM18_0210 (hasC2)
   00052 Galactose metabolism
    spyM18_0210 (hasC2)
   00500 Starch and sucrose metabolism
    spyM18_0210 (hasC2)
   00520 Amino sugar and nucleotide sugar metabolism
    spyM18_0210 (hasC2)
Enzymes [BR:spm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     spyM18_0210 (hasC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(190425..191324)
Genome map
AA seq 299 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTGKS
KRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIRQSHPRGLGDAVLQAKTFV
GNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVMRVPHEDVSNYGIIAPQA
KAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILEKQEPGAGNEVQLTDAIDT
LNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDLKAYIIQLGKALEKTKP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcagaaaagctattattcccgcagcaggtttaggcacacgttttttacct
gcaaccaaggcccttgccaaggagatgctacctattgttgataaaccaactattcaattt
atcgttgaagaagctctaaaatcaggtatcgaagaaattcttatcgttactggaaaatcc
aaacgctccatagaagatcattttgattctaattttgaattagaatataatttacaggct
aaaggaaaaatcgaacttctaaagttagtagacgagaccacttctattaaccttcacttt
attcgacagagtcatccaagaggattaggagacgcagttcttcaagcaaagacctttgtt
ggcaatgaaccttttgttgtcatgctaggtgatgatctgatggatattacaaatccaaat
gtaaaaccattaaccaaacaattgatcgatgactatgaagaaactcatgctgcaactatt
gccgtcatgagagttcctcacgaggatgtctctaactacggtatcattgctcctcaagca
aaagcagtaaaaggactctatagtgtggatacttttgttgaaaaaccacaacctcaagat
gcacctagtgatttggcaattattggacgttacttgctcacaccagaaatttttagtatt
ttagaaaaacaagaacctggtgcaggcaatgaagttcaactgactgatgctattgatacc
ctcaataagacacagcgtgtctttgctcgtgagtttaaagggaaacgctatgatgttggc
gataaatttgggtttatgaaaacttctttggattatgccctgaaacaccctcaagtcaaa
gatgacttgaaagcctacatcatccaactgggcaaagcactagagaaaacaaaaccataa

DBGET integrated database retrieval system