KEGG   Schizosaccharomyces pombe (fission yeast): SPAC18B11.07cHelp
Entry
SPAC18B11.07c     CDS       T00076                                 

Gene name
rhp6, sng1, ubc2
Definition
(RefSeq) ubiquitin-conjugating enzyme E2 2
  KO
K10573  
ubiquitin-conjugating enzyme E2 A [EC:2.3.2.23]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC18B11.07c (rhp6)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     SPAC18B11.07c (rhp6)
Ubiquitin system [BR:spo04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   SPAC18B11.07c (rhp6)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    SPAC18B11.07c (rhp6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(305723..305764,305812..305876,306090..306210,306316..306419,306468..306591)
Genome map
AA seq 151 aa AA seqDB search
MSTTARRRLMRDFKRMQQDPPAGVSASPVSDNVMLWNAVIIGPADTPFEDGTFKLVLSFD
EQYPNKPPLVKFVSTMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNNAS
PANAEAAQLHRENKKEYVRRVRKTVEDSWES
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgaccgcaagaagacgtctcatgcgagattttaagaggatgcagcaagatcct
cctgctggagtttcagcttcccctgtctctgacaatgtaatgctttggaatgctgttatc
attggcccagcagacactccatttgaagatggaacttttaagttggttctttcttttgat
gaacaatatcctaataaacctcctcttgtaaaattcgtctccacaatgttccatccaaat
gtgtacgcaaatggcgaactttgcttggacattctgcaaaacaggtggtctccaacttac
gatgtggcagcaattcttacctctattcaaagcttacttaatgatccaaataatgcgtcc
cctgcaaatgccgaagctgctcagctgcatcgtgaaaacaagaaggagtatgtgcgtcga
gtacgaaaaactgtagaagactcctgggaaagttga

DBGET integrated database retrieval system