KEGG   Schizosaccharomyces pombe (fission yeast): SPAC18B11.07cHelp
Entry
SPAC18B11.07c     CDS       T00076                                 

Gene name
rhp6, sng1, ubc2
Definition
ubiquitin-conjugating enzyme E2 2 (EC:6.3.2.19)
Orthology
K10573  
ubiquitin-conjugating enzyme E2 A [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC18B11.07c (rhp6)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     SPAC18B11.07c (rhp6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(305723..305764,305812..305876,306090..306210,306316..306419,306468..306591)
Genome map
AA seq 151 aa AA seqDB search
MSTTARRRLMRDFKRMQQDPPAGVSASPVSDNVMLWNAVIIGPADTPFEDGTFKLVLSFD
EQYPNKPPLVKFVSTMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNNAS
PANAEAAQLHRENKKEYVRRVRKTVEDSWES
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgaccgcaagaagacgtctcatgcgagattttaagaggatgcagcaagatcct
cctgctggagtttcagcttcccctgtctctgacaatgtaatgctttggaatgctgttatc
attggcccagcagacactccatttgaagatggaacttttaagttggttctttcttttgat
gaacaatatcctaataaacctcctcttgtaaaattcgtctccacaatgttccatccaaat
gtgtacgcaaatggcgaactttgcttggacattctgcaaaacaggtggtctccaacttac
gatgtggcagcaattcttacctctattcaaagcttacttaatgatccaaataatgcgtcc
cctgcaaatgccgaagctgctcagctgcatcgtgaaaacaagaaggagtatgtgcgtcga
gtacgaaaaactgtagaagactcctgggaaagttga

DBGET integrated database retrieval system