KEGG   Schizosaccharomyces pombe (fission yeast): SPAC22F8.11Help
Entry
SPAC22F8.11       CDS       T00076                                 

Gene name
plc1
Definition
phosphoinositide phospholipase C Plc1 (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SPAC22F8.11 (plc1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    SPAC22F8.11 (plc1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     SPAC22F8.11 (plc1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:4807786..4810485
Genome map
AA seq 899 aa AA seqDB search
MNCEMVTSPESVNLGDSNRAVSPFCLPDCSENAVAQTRSKTLDNAALDLPYVGNRKKSEQ
DFFKMLSSRDRDAHSTLRKRSNSLSSFLSTKSTSASENKFHGGLNWLSLKLNLLLRLQGR
MNSARTNTSMNPYSCDSNENLSTLSSVNQNFNSRQLLATIVPESIQNGCSLLRITKKKVR
QRKVSLDPISGYLMLDKNTGKAYKKLCVDDIKEIRQGRDARNYREQYKISSENEKRWFTI
IYCADNKLKAMHMISPTLDAHNQWIMALEGLKTYRLNEFIIGLNLVCHQGEKMIDYSENL
NPWEKLEKEQSAQLDLGDVHRMCQMLHLNASMEFLEETFQKADADHSGKLSFEEFQHFVS
LLKTRSEIVDIFKEYTSGSDKMSLEQFRHFLSTSQKARLDSDSIRTLYVSFCSNDDSKMG
LIEFTSFLLSPHNSPVVPVIQDMSRPLNEYLISSSHNTYLLGKQFGGESSIEGYIRSLQR
GCKCIEIDCWDGPNGPVVCHGHTFTSMIKFNDVIDAIRKYAFVVSPYPLFISLEIHCCPD
QQRQMVSYMKQAFGDTLVMKPVTANESVLPSPEDLLNKILLKVKCSATPLHQFSTDILKV
GITDSSTDTTESSELENSELTGLRKGKRRMKNIIVQELQQLAPYARSLKFRNFSLPESKT
YSHIFSFSERTIKKHGKAMVPRLSKHNLRYLCRVYPGPLRVGSTNFNPQVYWRLGVQMVA
LNWQTYDTGLQINDALFIADPPTGYLLKPPCQRIIGTTVGEEGLPRKIKLTIDVISGQQL
RRARELSNSETLSPYVEIQVHSMEESPFRWCSKVVHENGFRPFWGETMVYESIISDDFYS
MIRFLVHHRGSNGNDSIFANFTCPIDRLQQGYRHIRLLDMQGENLLFSSLFLKIKKEDI
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtgaaatggtaacgtcgcctgaatcggtcaacttaggagactccaacagagca
gtaagtccattttgcctgcccgattgctcagaaaacgcagttgctcagacgaggagtaaa
accttagataatgctgctttggatctcccatatgttggcaataggaagaaatcggagcag
gatttctttaagatgctatcatcaagggatcgcgatgctcatagtactctacgtaaacga
tcaaattctttatcttcttttctgagtacgaaatcgacatcagcttcagaaaataaattc
catggaggattgaattggctttctctgaagttaaatcttttgctacgcttgcaaggtcga
atgaattctgcgagaacaaatacttcaatgaacccttactcatgcgatagtaacgaaaac
ttatctactctgagctcggtgaatcaaaactttaattctcgacagctattagctactata
gtccctgaatctattcaaaacggatgctctttacttcgtataaccaagaaaaaggtgcgc
caacgtaaagtctctttagaccctatatctggatatcttatgctggacaagaatactggt
aaagcttataagaagctttgtgttgatgacattaaagaaattcgacagggccgcgatgct
cgtaattatagagaacagtacaaaatttcttctgagaacgagaaacgctggttcacaatt
atatattgtgctgataataaattaaaggctatgcatatgatatctccaactttagatgcg
cataatcaatggattatggctttagaaggtctaaaaacttatcgattgaatgaatttatt
attggacttaatctcgtttgccatcaaggtgaaaaaatgatagattattcagagaattta
aatccctgggaaaagttagaaaaggagcaaagtgcacagttggatctaggagacgtgcat
cgcatgtgccaaatgctacatttgaatgcatcaatggagtttttagaagaaacatttcaa
aaggcagatgctgatcattctggaaagctaagttttgaagaatttcagcattttgtaagc
cttttaaaaacaagatccgagattgtagatatttttaaagaatatacatctggctctgac
aagatgtctttggaacagtttcgtcactttctatcaacttctcaaaaggctcgtttggat
agtgactcaattaggactttgtatgtctctttttgctcaaatgatgattcaaaaatgggt
ttgatagaatttacttcctttctactttctcctcataattctccagtagttcctgtgata
caagatatgtcgcgaccactgaatgaatacttaatttcttcgtcgcataacacttattta
ctaggtaagcagtttggtggagaaagttcaattgaaggttatatccgttcgctacagcgt
ggctgcaagtgtattgaaatcgattgctgggatggaccgaatggtcctgtagtttgtcat
ggacatacatttacttctatgataaaatttaatgatgttattgatgctatacgaaaatat
gctttcgtcgtttcaccttatccattattcatttctttggaaattcattgctgccctgac
caacaacgtcaaatggttagttacatgaaacaagcatttggggatactttggtgatgaaa
cccgttaccgctaacgaatcagttcttccttcacccgaagatttactgaacaaaattttg
ctgaaagtcaaatgttcagcaacaccattgcaccaattttcgacagacatactgaaggtt
gggataactgattcttcgactgatactaccgaatcatcggagctagaaaattcagaatta
acagggttaaggaaaggtaaaagacggatgaaaaatatcattgtgcaggaattgcaacag
cttgcaccttatgcccgatcattgaaatttcgaaatttttctttaccggaatcaaaaacg
tatagccacatattctcattttcggaaaggactataaaaaagcatggaaaagctatggtt
ccaagacttagcaaacataatttacgctatttgtgtcgtgtataccctggcccattgaga
gtaggaagtacaaattttaatcctcaggtgtattggcgcctgggtgtgcaaatggttgct
ctaaactggcaaacttatgatacaggtcttcaaataaatgatgctttgtttatagctgat
cctccgactgggtacttgttaaagccaccttgtcaacgaataattggtacaacagttggc
gaagaaggacttcctcgtaaaataaaattaacaatagatgtcatatctgggcaacaactt
agaagagctagagaactttctaattctgaaactctcagcccttatgttgagatccaagtt
cattcaatggaagaatctccttttcgttggtgttccaaagttgtgcacgaaaatggattt
cgacctttttggggagaaaccatggtttatgagagtataattagtgatgacttttattcc
atgatccgatttctcgtccatcatcgaggaagtaatggaaatgactctatatttgctaat
tttacttgtccgattgacagactgcaacaaggctatagacatattcgtttattggatatg
caaggcgaaaatttgttattttcgagtttgtttttgaaaattaaaaaagaagacatttag

DBGET integrated database retrieval system