KEGG   Schizosaccharomyces pombe (fission yeast): SPAC31G5.09cHelp
Entry
SPAC31G5.09c      CDS       T00076                                 

Gene name
spk1
Definition
MAP kinase Spk1
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     SPAC31G5.09c (spk1)
Protein kinases [BR:spo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   SPAC31G5.09c (spk1)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPAC31G5.09c (spk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(2999850..3000968)
Genome map
AA seq 372 aa AA seqDB search
MASATSTPTIADGNSNKESVATSRSPHTHDLNFELPEEYEMINLIGQGAYGVVCAALHKP
SGLKVAVKKIHPFNHPVFCLRTLREIKLLRHFRHENIISILDILPPPSYQELEDVYIVQE
LMETDLYRVIRSQPLSDDHCQYFTYQILRALKAMHSAGVVHRDLKPSNLLLNANCDLKVA
DFGLARSTTAQGGNPGFMTEYVATRWYRAPEIMLSFREYSKAIDLWSTGCILAEMLSARP
LFPGKDYHSQITLILNILGTPTMDDFSRIKSARARKYIKSLPFTPKVSFKALFPQASPDA
IDLLEKLLTFNPDKRITAEEALKHPYVAAYHDASDEPTASPMPPNLVDLYCNKEDLEIPV
LKALIFREVNFR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgctacttccacgcctactattgcggatgggaattccaacaaggagtcagta
gctacaagtcgaagcccacacacgcatgatctaaactttgagctaccagaggaatacgaa
atgatcaatctcatcggtcaaggtgcttatggagttgtatgtgccgcgcttcacaaaccc
agcggcctaaaggtggctgttaaaaaaatacatcctttcaatcatcctgtgttttgtcta
agaactttaagggaaatcaagttactcagacattttcgtcatgaaaatataatttcaatt
ctagacatccttccaccaccgagctaccaggaattggaagatgtttatattgtacaagag
cttatggaaacggatttgtaccgtgttatacgttcgcagcccttaagcgatgatcattgt
caatactttacgtatcaaattttgcgcgctctgaaagccatgcatagtgctggagttgtt
catagagacctgaagccatcaaacttactactaaatgccaattgtgatctcaaagttgcc
gatttcggtttggcacgttccaccacagctcaaggcggaaatcctggctttatgactgag
tatgtcgcaactcgttggtatcgagcaccggaaattatgctgagtttccgagaatacagc
aaagctattgatttatggagtactggttgtatacttgctgagatgctttctgctcgacca
ttgttcccaggaaaggactatcatagtcaaattactttaatccttaacattctaggaacg
cctactatggacgatttttcaagaattaaatctgcacgtgcgaggaaatatattaaaagt
cttccatttactcctaaagtatcattcaaagcactctttcctcaggcatcaccagatgct
attgaccttttagaaaaattactgacatttaatcctgataagcgtataactgcagaagag
gctctaaagcacccgtatgtagctgcttatcatgatgccagtgatgagcctacagcatcc
cccatgcctcccaacctcgtcgatttatactgtaacaaagaagatctcgaaataccggta
ttgaaggccttaatatttcgtgaagtaaatttcagataa

DBGET integrated database retrieval system