KEGG   Schizosaccharomyces pombe (fission yeast): SPBC12D12.02cHelp
Entry
SPBC12D12.02c     CDS       T00076                                 

Gene name
cdm1
Definition
(RefSeq) DNA polymerase delta subunit Cdm1
  KO
K03505  
DNA polymerase delta subunit 4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SPBC12D12.02c (cdm1)
   00240 Pyrimidine metabolism
    SPBC12D12.02c (cdm1)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SPBC12D12.02c (cdm1)
   03410 Base excision repair
    SPBC12D12.02c (cdm1)
   03420 Nucleotide excision repair
    SPBC12D12.02c (cdm1)
   03430 Mismatch repair
    SPBC12D12.02c (cdm1)
   03440 Homologous recombination
    SPBC12D12.02c (cdm1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      SPBC12D12.02c (cdm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(2305758..2306240)
Genome map
AA seq 160 aa AA seqDB search
MKKRTTQAKKSGQNTNIRDVFPHVVRSNSSQSHIGKKVSSEQSPTPDVTITTKTLDERIK
EDDELSKEVEEAWNQIMAERISEPIHCENITKVEFILHHFDTTARYGPYLGMTRMQRWKR
AKNFNLNPPETVGKILMLEEADEENRKRESLFYDLQTIPG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcgcactactcaagcgaaaaaatcagggcaaaacactaatattcgcgacgtg
tttccacatgtagttcgaagtaattcaagtcaatcccacatagggaagaaagtgagttct
gaacagtcgcctacacccgatgttacaattacaaccaaaaccttggatgagagaattaaa
gaagacgatgagctttcaaaagaggtagaagaggcttggaatcaaattatggctgaaagg
attagtgaaccaatacattgtgaaaatataaccaaagtagagttcattttgcatcacttt
gacactacggcaagatatggaccatatcttggtatgacaaggatgcaacgctggaaacgt
gcaaaaaacttcaatttaaatcctccagaaacagtgggaaagatattgatgctcgaggaa
gcagatgaggaaaatcgaaaaagagaatcgctcttttatgatcttcaaaccattccaggc
tag

DBGET integrated database retrieval system