KEGG   Schizosaccharomyces pombe (fission yeast): SPBC17D11.02cHelp
Entry
SPBC17D11.02c     CDS       T00076                                 

Gene name
hrd1
Definition
(RefSeq) ubiquitin-protein ligase Hrd1, synviolin family
  KO
K10601  
E3 ubiquitin-protein ligase synoviolin [EC:2.3.2.27]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPBC17D11.02c (hrd1)
   04120 Ubiquitin mediated proteolysis
    SPBC17D11.02c (hrd1)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     SPBC17D11.02c (hrd1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    SPBC17D11.02c (hrd1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(join(3306554..3308563,3308607..3308630))
Genome map
AA seq 677 aa AA seqDB search
MKFILYVLASLVLFGLSVLLSLYSSANVYSATVMISQSPVHITIGLNVCLCLFFAIANAL
KTLLFGSLQTFELELLYEQFWITLTEIMLAITVFREAISISFFMLLSTLMFARVFHSICS
FRTERLQIQLTDQRFHIFSRLTCAYFVLSILDASLIYLCFTSEHLGDKSTRMLFVCEFSV
LLLNLTIEASKLCIYLYEARHLDQVWDEKSTYLFRLEVCRDGLRLLAYSLLFMYQFPYVS
VPIYSIRQMYTCFYSLFRRIREHARFRQATRDMNAMYPTATEEQLTNSDRTCTICREEMF
HPDHPPENTDEMEPLPRGLDMTPKRLPCGHILHFHCLRNWLERQQTCPICRRSVIGNQSS
PTGIPASPNVRATQIATQVPNPQNTPTTTAVPGITNSSNQGDPQASTFNGVPNANSSGFA
AHTQDLSSVIPRRIALRDGWTMLPIPGTRRIPTYSQSTSTTNPSATPTTGDPSNSTYGGP
QTFPNSGNNPNFNRGIAGIVPPGWRLVSSNTQSLSTNSAMTSLYQNASSADNNLGSSLPN
VVPLSRGLTQSNETSNTFPAASSNISSQLRELHTKIDELRETVSNFRADYNSIRTSLNQL
EAASGINERIQTTSADSLLNSNGMSGTEGFENTQTSITTNDNQSSILTSSDQTSPFATDE
DRQNSRNVQLETVDENF
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttatactatatgtgttagcttccttggtgctgtttggactgtcagtcttgttg
agtttgtacagtagtgcaaacgtgtactcggcgacagtaatgatttctcaaagtcctgtt
catataacaattggactgaacgtttgtttatgtctgttttttgcgattgccaatgcctta
aaaacattattgtttggttcgcttcagacattcgaacttgagcttttatatgaacaattt
tggataacccttactgaaataatgcttgcgatcactgtttttagagaagccatatctatt
tctttctttatgttgttaagtactttgatgtttgctcgggtgtttcattccatatgttct
tttcgcacagaaagattgcagattcagcttacagatcagcgttttcatattttcagtcgc
ctaacttgcgcatactttgtactttctatactggatgcatctcttatttacctttgtttt
acgagcgagcatcttggcgataaatcgacacgtatgcttttcgtatgtgaattctcggtc
ctccttttaaatctcacaattgaggcatctaagctttgcatatatttgtatgaggctaga
cacctcgatcaggtttgggatgaaaaaagtacttatcttttccgacttgaggtttgtcga
gatggtttacgccttcttgcatacagccttttattcatgtatcaatttccctatgtctca
gttcctatttattccatccgtcaaatgtacacatgtttttactcgttgttcaggcgtata
cgtgagcatgcgcgtttccgacaagcaactcgcgatatgaacgccatgtatccaactgct
actgaagaacagcttacgaattcagatagaacatgtactatttgtagggaagaaatgttt
catccagatcatcctccagaaaacaccgacgaaatggaacctctacctagaggtttagat
atgactcctaaacggcttccctgtggccatattttacatttccattgccttagaaattgg
ctagaaagacaacaaacatgtccaatttgtagaagatccgttattggaaatcaatcttcc
ccaacgggaattcctgcaagtcccaatgttcgagctactcaaatcgcaacccaagttcct
aacccgcaaaacactcctaccacaactgcagtaccaggcatcactaactcttctaatcaa
ggagaccctcaggcatcaactttcaatggagtgccaaatgcgaatagtagtggatttgca
gctcatactcaagatctttcgtcagtgatcccaaggagaattgccttacgtgatggttgg
actatgcttccaattcctggaacgcgtcgtattccgacttattctcaatccacatcaacg
acaaatcctagtgctacgcctactactggggatccatcgaattccacgtatggtggccct
caaacatttccgaattctggaaataatccaaactttaaccgtggaatagcaggaattgtc
cctccgggatggcgactagtatctagcaatactcaatctctatctaccaactcagcaatg
acatctttatatcaaaacgcatcatcagcagataataatcttggctcctctttacccaac
gttgtaccattgagtagaggattaacacagtcgaatgaaacgtctaatacgtttcccgct
gcttcatctaatatatcttctcagcttcgtgaacttcataccaaaattgatgaattacga
gaaacggtttctaactttcgtgctgattacaatagtatacgtacatctttaaatcagtta
gaagctgcaagtggtattaatgaaaggatacaaactacttctgctgattcactattaaat
tccaatggtatgagtgggactgaaggatttgagaatacgcagacttccattacaacgaac
gacaatcaatcatcgatcttaaccagttcagatcaaacatccccatttgcaactgatgaa
gatcgacaaaactcacgaaatgtacaattagaaactgtggatgaaaatttttga

DBGET integrated database retrieval system