KEGG   Schizosaccharomyces pombe (fission yeast): SPBC17D11.02cHelp
Entry
SPBC17D11.02c     CDS       T00076                                 

Gene name
hrd1
Definition
ubiquitin-protein ligase Hrd1, synviolin family
Orthology
K10601  
E3 ubiquitin-protein ligase synoviolin [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPBC17D11.02c (hrd1)
   04120 Ubiquitin mediated proteolysis
    SPBC17D11.02c (hrd1)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     SPBC17D11.02c (hrd1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(join(3306554..3308563,3308607..3308630))
Genome map
AA seq 677 aa AA seqDB search
MKFILYVLASLVLFGLSVLLSLYSSANVYSATVMISQSPVHITIGLNVCLCLFFAIANAL
KTLLFGSLQTFELELLYEQFWITLTEIMLAITVFREAISISFFMLLSTLMFARVFHSICS
FRTERLQIQLTDQRFHIFSRLTCAYFVLSILDASLIYLCFTSEHLGDKSTRMLFVCEFSV
LLLNLTIEASKLCIYLYEARHLDQVWDEKSTYLFRLEVCRDGLRLLAYSLLFMYQFPYVS
VPIYSIRQMYTCFYSLFRRIREHARFRQATRDMNAMYPTATEEQLTNSDRTCTICREEMF
HPDHPPENTDEMEPLPRGLDMTPKRLPCGHILHFHCLRNWLERQQTCPICRRSVIGNQSS
PTGIPASPNVRATQIATQVPNPQNTPTTTAVPGITNSSNQGDPQASTFNGVPNANSSGFA
AHTQDLSSVIPRRIALRDGWTMLPIPGTRRIPTYSQSTSTTNPSATPTTGDPSNSTYGGP
QTFPNSGNNPNFNRGIAGIVPPGWRLVSSNTQSLSTNSAMTSLYQNASSADNNLGSSLPN
VVPLSRGLTQSNETSNTFPAASSNISSQLRELHTKIDELRETVSNFRADYNSIRTSLNQL
EAASGINERIQTTSADSLLNSNGMSGTEGFENTQTSITTNDNQSSILTSSDQTSPFATDE
DRQNSRNVQLETVDENF
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttatactatatgtgttagcttccttggtgctgtttggactgtcagtcttgttg
agtttgtacagtagtgcaaacgtgtactcggcgacagtaatgatttctcaaagtcctgtt
catataacaattggactgaacgtttgtttatgtctgttttttgcgattgccaatgcctta
aaaacattattgtttggttcgcttcagacattcgaacttgagcttttatatgaacaattt
tggataacccttactgaaataatgcttgcgatcactgtttttagagaagccatatctatt
tctttctttatgttgttaagtactttgatgtttgctcgggtgtttcattccatatgttct
tttcgcacagaaagattgcagattcagcttacagatcagcgttttcatattttcagtcgc
ctaacttgcgcatactttgtactttctatactggatgcatctcttatttacctttgtttt
acgagcgagcatcttggcgataaatcgacacgtatgcttttcgtatgtgaattctcggtc
ctccttttaaatctcacaattgaggcatctaagctttgcatatatttgtatgaggctaga
cacctcgatcaggtttgggatgaaaaaagtacttatcttttccgacttgaggtttgtcga
gatggtttacgccttcttgcatacagccttttattcatgtatcaatttccctatgtctca
gttcctatttattccatccgtcaaatgtacacatgtttttactcgttgttcaggcgtata
cgtgagcatgcgcgtttccgacaagcaactcgcgatatgaacgccatgtatccaactgct
actgaagaacagcttacgaattcagatagaacatgtactatttgtagggaagaaatgttt
catccagatcatcctccagaaaacaccgacgaaatggaacctctacctagaggtttagat
atgactcctaaacggcttccctgtggccatattttacatttccattgccttagaaattgg
ctagaaagacaacaaacatgtccaatttgtagaagatccgttattggaaatcaatcttcc
ccaacgggaattcctgcaagtcccaatgttcgagctactcaaatcgcaacccaagttcct
aacccgcaaaacactcctaccacaactgcagtaccaggcatcactaactcttctaatcaa
ggagaccctcaggcatcaactttcaatggagtgccaaatgcgaatagtagtggatttgca
gctcatactcaagatctttcgtcagtgatcccaaggagaattgccttacgtgatggttgg
actatgcttccaattcctggaacgcgtcgtattccgacttattctcaatccacatcaacg
acaaatcctagtgctacgcctactactggggatccatcgaattccacgtatggtggccct
caaacatttccgaattctggaaataatccaaactttaaccgtggaatagcaggaattgtc
cctccgggatggcgactagtatctagcaatactcaatctctatctaccaactcagcaatg
acatctttatatcaaaacgcatcatcagcagataataatcttggctcctctttacccaac
gttgtaccattgagtagaggattaacacagtcgaatgaaacgtctaatacgtttcccgct
gcttcatctaatatatcttctcagcttcgtgaacttcataccaaaattgatgaattacga
gaaacggtttctaactttcgtgctgattacaatagtatacgtacatctttaaatcagtta
gaagctgcaagtggtattaatgaaaggatacaaactacttctgctgattcactattaaat
tccaatggtatgagtgggactgaaggatttgagaatacgcagacttccattacaacgaac
gacaatcaatcatcgatcttaaccagttcagatcaaacatccccatttgcaactgatgaa
gatcgacaaaactcacgaaatgtacaattagaaactgtggatgaaaatttttga

DBGET integrated database retrieval system