KEGG   Streptococcus pneumoniae P1031: SPP_0884Help
Entry
SPP_0884          CDS       T00874                                 

Gene name
pfkB
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:spp00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SPP_0884 (pfkB)
Enzymes [BR:spp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     SPP_0884 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
803610..804521
Genome map
AA seq 303 aa AA seqDB search
MIYTVTLNPSIDYIVRLDQVKVGSVNRMDSDDKFAGGKGINVSRVLKRLNIPNTATGFIG
GFTGKFITDTLAEEEIETRFVQVAEDTRINVKIKADQETEINGTGPTVEPVQLEELKAIL
SSLTAEDTVVFAGSSAKNLGNVIYKDLISLTRQTGAQVVCDFEGQTLIDSLDYQPLLVKP
NNHELGAIFGVKLESLDEIEKYARELLAKGAQNVIISMAGDGALLVTSEGAYFAKPIKGT
VKNSVGAGDSMVAGFTGEFVKSKDAVEAFKWGVACGTATTFSDDLATAEFIKETYGKVEV
EKR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacagtcacactcaatccatccattgactatatcgttcgtttggaccaagtc
aaagttggtagtgtaaatcgtatggacagtgatgataagtttgctggtgggaaaggaatc
aatgtcagccgtgtcttgaaacgtttgaatataccaaatacagcgacgggatttatcggt
ggctttactggtaaatttatcacagatactttagcagaggaagaaatcgagacacgtttt
gtccaggtggcagaagatactcgtatcaatgttaaaatcaaagcagaccaagaaacagaa
atcaacggaacgggtccaactgttgaaccggttcagctagaagaattgaaagctatttta
tctagtctgacagcagaagatacagttgtctttgcaggttcaagtgctaaaaatctaggc
aatgttatctataaggatttgatttccttgacgcgccagactggtgcgcaagtggtctgt
gactttgaaggacagaccttaattgatagtttggactaccagcctcttcttgtaaaacca
aacaatcatgaacttggagcgatttttggggttaaactcgaaagtttagatgaaattgag
aaatacgctcgtgagttactggctaagggtgctcaaaatgttattatctctatggctggt
gatggcgcccttcttgtcacatctgagggagcttacttcgctaaaccaatcaaaggaaca
gtcaaaaattcagttggagctggtgattctatggttgctggattcacaggtgaatttgtc
aaatcaaaagacgcagtagaagccttcaaatggggagtggcttgcggaacggcaactacc
ttctcagatgacttggcaacggcggaatttattaaagaaacatatggaaaagttgaggta
gaaaaaagatga

DBGET integrated database retrieval system