KEGG   Streptococcus pneumoniae P1031: SPP_2105Help
Entry
SPP_2105          CDS       T00874                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:spp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPP_2105 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPP_2105 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPP_2105 (thrC)
Enzymes [BR:spp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SPP_2105 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1923702..1925186)
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDANNTVTASQAILQGLATDGGLFTPVTYPKVDLDFDKLKDASYQEVAKLVL
SAFLDDFTAEELDYCINNAYDSKFDTPAIAPLVKLDGQYNLELFHGSTIAFKDMALSILP
YFMTTAAKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKGGVSKVQELQMT
TQNGDNTHVIAIDGNFDDAQTNVKHMFNDVALREKLTTNKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIVAGEKVNFTVPTGNFGNILAAFYAKQIGLPVGKLICASNDNNVLTD
FFKTRVYDKKREFKVTTSPSMDILVSSNLERLIFHLLGNNAEKTAELMNALNTQGQYKLT
DFDAEILDLFAAEYATEEETAAEIKRVYESDSYIEDPHTAVASAVYRKYQAVTGDVTKTV
IASTASPYKFPVVAVEAVTGKAGLTDFEALAQLHEISGVAVPPAVDGLEIAPIRHKTTVA
AADMQAAVEAYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtttatcaatcaacgcgtgatgccaacaatacagtaactgccagccaagca
attttgcaaggtttggcgacggacggcggtttgtttacaccggttacttatccaaaggta
gatttggactttgacaaattgaaagatgcttcttaccaggaagttgctaagctagttttg
tcagcatttttagatgactttacagctgaggagttggactactgtatcaacaatgcctac
gatagcaaatttgatactccagctattgcaccattagtgaaattagatgggcaatacaat
ttggaacttttccatggttcaacgattgcctttaaggatatggccttgtctattttgcca
tactttatgacgactgctgctaagaaacatggtttggagaacaagattgttatcttgaca
gcgacatctggtgacacggggaaagctgctatggcggggtttgcggatgtgcctggtact
gagattatcgtcttttatccaaagggtggtgtcagcaaggtacaagagttgcaaatgacc
actcagaatggtgacaatactcatgttattgctattgatggtaattttgacgatgcgcaa
acaaatgtgaagcacatgtttaacgacgtggctcttcgtgaaaaattgactaccaacaag
ttgcaattttcatcagctaactctatgaacattggtcgtctggtgccacaaattgtttat
tatgtttatgcttacgctcaattggttaagactggtgaaattgtagctggtgaaaaggtt
aacttcacagtaccaacaggaaactttggaaatatcttggctgccttttatgccaaacaa
atcggcctaccagttggcaagctaatctgtgcttcaaatgacaataatgtcttgacagac
ttctttaaaacacgtgtctatgacaaaaaacgtgagtttaaggtaacaaccagcccatct
atggatatcttggtatcttcaaacttggagcgcttgattttccatcttttgggaaataat
gctgaaaagacagctgaacttatgaatgccttgaacacgcaaggacaatataagttgaca
gactttgatgcagagattttggacctctttgcagctgaatatgcgactgaggaagaaaca
gcggcagaaatcaagcgtgtttatgagtcagattcttatattgaggatccacatacggcg
gttgcctcagcagtttatagaaaataccaagcggttactggagatgtaactaagacagtg
attgcttcaacagctagtccatacaagttcccagtagttgcagtagaagctgtaactgga
aaagcaggtttgacagactttgaagccttggctcaattacatgaaatctcaggcgttgca
gtgccaccagcagttgatgggcttgaaatagctccaattcgtcacaagacaacagtggca
gctgctgacatgcaagcagcggttgaggcttatttaggactttaa

DBGET integrated database retrieval system