KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA1518Help
Entry
SPA1518           CDS       T00219                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase isozyme
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
spt00010  Glycolysis / Gluconeogenesis
spt00030  Pentose phosphate pathway
spt00051  Fructose and mannose metabolism
spt00052  Galactose metabolism
spt00680  Methane metabolism
spt01100  Metabolic pathways
spt01110  Biosynthesis of secondary metabolites
spt01120  Microbial metabolism in diverse environments
spt01130  Biosynthesis of antibiotics
spt01200  Carbon metabolism
spt01230  Biosynthesis of amino acids
Module
spt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPA1518 (pfkB)
   00030 Pentose phosphate pathway
    SPA1518 (pfkB)
   00051 Fructose and mannose metabolism
    SPA1518 (pfkB)
   00052 Galactose metabolism
    SPA1518 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    SPA1518 (pfkB)
Enzymes [BR:spt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SPA1518 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: AAV77451
UniProt: A0A0H2WPH3
Position
1592818..1593750
Genome map
AA seq 310 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIAHLGGTATAIFP
AGGATGEHLVALLADENVPVSTVDAKDWTRQNLHVHVESSGEQYRFVMPGATLDDDEFRQ
LEEQVLEIESGAILVISGSLPPGVKVEKLTQLISAAQKQGIRCIIDSSGDALTAALALGD
IELVKPNLKELSALVNRDLTQPDDVRKAAQELVQSGKARRVVVSLGPQGALGIDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAQDASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSAQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacgcttgcgccctctctcgatagcgcaacaatcacgccg
caaatttatcccgaaggtaaactgcggtgctccgcgccggtattcgaacccggcggcggg
ggtattaatgtcgctcgcgccattgcgcatcttggcggcaccgcgaccgcaattttcccg
gctggcggcgctaccggcgaacatctggtcgcactactggctgacgaaaatgtccccgtg
tctaccgtcgatgcgaaggactggacgcgtcagaacctgcacgtccacgtcgagtccagc
ggcgaacaatatcgttttgttatgcccggcgccacgctggacgatgacgaatttcgccag
cttgaagaacaggtactggaaattgaatccggggcaattctggttatcagcggcagcctt
ccgcccggcgttaaggtcgagaaactcacgcaactgatttccgccgcgcagaagcaaggc
attcgctgcattattgatagctctggcgacgcgctcaccgctgcgttggcgcttggcgat
atcgaactggtgaaacctaacctgaaagaattgagcgcgttagtcaatcgcgatctgacg
cagcctgatgatgtgcgtaaagcggcccaggaattagtgcaaagtggcaaggctcgccgg
gtagtggtctctctggggccgcaaggggcgctgggcatagacagtgagaattgcatccag
gttgttcctcccccggtgaaaagtcaaagtactgtcggcgcaggcgacagtatggtgggc
gcgatgacgttaaaactggcgcaagacgcgtcgctggaagagatggtgcgcttcggtgtg
gcggcaggcagcgccgctacgctcaatcaaggtacgcgtctgtgttctcatgacgatacc
caaaaaatatacgcctatctttccgcgcaataa

DBGET integrated database retrieval system