KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592001Help
Entry
592001            CDS       T01019                                 

Definition
ubiquitin carboxyl-terminal hydrolase 24-like
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     592001
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   592001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2693 aa AA seqDB search
MEPSEENVQMLINMGFGDLTDIKKALRLAQNDVNEAVAILTQEQPGLSYETVEEETKEAP
PPGTLRRTFGPQNRLAPDPPPPSYDEAVEPVEDEDPSSSSVEAREEESVEVSKEFPQGNL
YELEGRVFTDQWSIPYKKEESLGKCLVAATRLASEGLLENDENCVRFVNRCMPEAFRKLM
TSKAVHRWGAEIHEGIYNMLQLFIELVAVRLKYKPVPIELLEVLGMALNPETEFHYKNRA
KKWDHIFWEEKFGVNSTFAVSPPFETYKDPCGWLVNLINAFAYHGGMDQIRDRVLESLDD
VDPPTLSTLMQPLGYCGEYLNPLKFAPFMSQVEKQVLKYVQDLKEHELKRKKTGSISELL
TTMKCLCLHFWVDDVKKVDDLRLSVALRMLNSPHFNAKMNSLKEITKMIEDTSISSRNRN
AIEEEVILDWLVENKVLSVALEGNIDQSQYADKLKGIVEFLGPKLSIEDLTKIWKMQNDQ
PLTVVDNIHSIMAAAAVKFSGEQLEHLFHLIQKAWQNENERVQEKLLSLIGRIGRDARSP
KTTCKVLELLWDLAHLPAIPKNHMEHALEEHLFILSDSLAVGMQIKNKYVAKCVEDIKRV
RTLILLXFNENKFVFVVPALRQIHQIAKGITKQSYSKTDKSLPQELNKTYDIIKLTTQSL
MKCHKMAINAAGQDGLSGSTIVDGKYTHCEHVEIHLKFLAFILQEGALYLQWHRAREIWD
TLVANPEACEADRETCYEWFRHGLADLETETQMQLFKDKLLRLESTHLSPMGFDCVRAFF
ESINTNNHSLRKGATGLIVEKLDLFGLDFMWKMVLESTNESIAEMAIRQIMSMSYTNLAQ
RLKKDVLDLHKHFISECYKRLELAYMAVKGTAMAEAVAMATKTLTAVSVPEAAIVPCPSR
AGKLLEIERLLQLAETYVVTVEDQFTSPRTILPHGASFQGHTITMHVTCTDSHRSEFVIV
GHSNETLQSVRHKIAQRLKTTLDNVQIMAHDRLMLTTKDQKLLSELEFDEEQDLNIKLHG
PVSSTVSSSARIDENMSSFGQQSELERSLPGVVMATGGQVFDMLYQTADIDEPRITERVR
KLLMMIPTDPSIPESLDSICRQVLSSKLMPSMQEDIGTQTSAQNFRESFLNAGGLSLVIN
ALQKDSIPQXXXXXXXXXXXXXXXXXXRQINETLQSVRHKIAQRLKTTLDNVQIMAHDRL
ESDLSLNDSSVFDNSGADSSTVFSSSYGSSPRKMSLLERISSVEASGDLANREGTSVAIT
VIQTMNANDFTSMIACLMRVTWAAAAGQLRLASASQPIKEVAGGGFAMGIGRRSRHSSAG
STNSSSSHDSESQVLHAGICLNTTAVSGKDAAIAREALELLVACLQLRTHNLGALYTLPG
VNDFIIDILLSSPHPEVRGAALDQFYTLTSTSISNESVRILHPRDFVLQVLLQARVPLWT
SSSLVRGANQRILNQSAQYFELRCRLLEGLRVNEQKFLKVNIVSMLGDEIDWLHNFEPGD
SEDMNLSSTDNTIVAGHLHLIRTLLTCEGVDKRKIGERLLNSLLNEYLFPASRLVMHQGD
NSEKGDSRRDYNSKISGKESRVAAFELLVVLCEGCPYNLQRIASQLINMHHQLDPSIAKE
WEFLPPVEGRMTKYVGVKNGGATCYMNAVIQQLYMTPGIREGILAGHTPEKEKGEDTIFY
QMQNVFGHLLESKLQYYEPERFWQVFKFWGEPVNVREQQDAFDFFTILTDQLDEYLKKSG
QKEVMKQKFQGLYLNQMICQDCPHRKEREEEFFALNLTVKSNNLNDSLEQFVRGEMLEGE
NAYLCEECNEKGILAGHTPEKEKGEDTIFYQMQNVFGHLLESKLQYYEPERFWQVFKFWG
EPVNVREQQDAFDFFTILTDQLDEYLKFPWVLDMEPFTSKGMARREQQQQQADDPPSPMN
YQRHVSSQSSTDDLYQLVGVVVHSGQANAGHYYSFIKDRGLTLCFPWVLDMEPFTSKGMA
RREQQQQQADDPPSPMNYLRHVSSQSSTDDLYQLVGVVVHSGQANAGHYYSFIKDRGGTS
MTNMSKGKWFRFNXXXXXXXXXXXXXXXXXXLCPLSGSYGPENRLRTWSGYMLFYEKMEG
MRSPDPMARIGRKGYHGDIHGSMDGLSSPELSPTGDRMSELSALVHKGEKRGFFLDKMPA
PIQRQIEDENLQFLKNRAVYNQEYITFVRKLASCSLHMTYHPAYSMMAQQSIKLAMHFVL
NTLFRTKKKLRYDLEDWRDLIDSIVKDSPEACEWALEVLASSQGRDYLKAFLLECPSQEV
RMAMANIVKSVMQSFVLRSHDTHQANLDFILEHLLSLLDKEVLEHCRSCVQYFWLLSMYL
ELGSDTCEHLFRRKAFQRLITFLIGPPSELNDLDIQTRRWTSLQTREFGFLHTMLAAMVL
HSDVSPYWSVDLGDKPKRRPILILENLNRLLPVPEDMRHTLFGPPCLKYIKESVLAFREV
HSSTTPILDMLLHCSFCNEGFTFNVMMIIHSQVSSAPANELKAIFVLLLELLLLDDPLQL
IRLKLAMEGNESNGLFSIIRNCTGNDSRRSYQCIKFLVHLSNKSPAAKEYLTSVSQKWHW
AVNWLKKKMTEHYWNPQSSISNESSTSKGFQRTMSAQDTLAEATALLTDLTTQDEDEDDD
AITKEEDEGEETTEGTVTPRMEVNGSSEGSEVNGNGGGEKPTEKISGIDDVDG
NT seq 8082 nt NT seq  +upstreamnt  +downstreamnt
atggagcctagcgaagaaaacgtccaaatgctcataaatatgggttttggagaccttaca
gatatcaagaaagcactccgccttgcacagaacgacgtgaacgaggcagtggctattctc
acgcaggaacaaccgggtctgagttatgaaacagtggaggaggaaacgaaggaagcaccg
ccaccgggaactctccggcggacatttggaccgcaaaaccgtctcgcacccgacccgccc
cctccttcctatgacgaagctgttgaaccagtggaggatgaagatcctagctccagcagc
gtggaagcaagagaggaggagagtgtggaagtttccaaggagttccctcaaggaaatctt
tacgagctggagggcagagttttcactgaccagtggtcaataccttacaagaaagaggaa
tcgctggggaaatgtttggtcgctgccaccagattagccagtgaaggtttgctggagaat
gatgagaactgcgtgcgttttgtgaaccgatgcatgcctgaagctttccgtaagctcatg
acttccaaggcagttcatcgatggggcgctgagatccatgaaggcatctataacatgcta
cagcttttcattgagctagtggctgtcagactcaaatataaacctgtacccatagagctt
cttgaggtccttggcatggccttaaacccagagacagagttccattataagaacagggcc
aagaaatgggaccatatattctgggaagagaagtttggtgtgaacagcacattcgccgta
agcccgcccttcgagacgtacaaggacccctgtggatggctcgtcaatctgatcaatgct
tttgcttaccatggaggtatggatcagattcgagacagagtactggaatcgttagatgac
gtggatcctccgactctatctacattgatgcagccgctgggttactgtggagagtacctg
aaccctctcaagtttgcccccttcatgagtcaggttgagaaacaggtcctcaagtatgtc
caggacctcaaggaacatgaactcaagagaaagaaaaccgggagtatctctgagttgctg
actaccatgaagtgtctttgccttcacttctgggtagacgatgttaagaaggtcgatgac
ctgagactaagcgtggctctgcgtatgctcaactctcctcacttcaatgctaagatgaac
agtctcaaggagattaccaagatgatcgaggatacaagtatatccagcaggaatcggaat
gctattgaggaagaggtcatcttggactggttggtggagaataaagttctatcagtagca
ctcgaaggtaatatagaccagtcccagtatgctgacaagctgaagggcatcgttgagttc
ctaggaccaaaactctccattgaagatctcaccaagatatggaagatgcagaacgaccaa
ccactgaccgtagtggacaacatccattccatcatggcagctgcagcggtcaagttcagt
ggcgagcagctggaacacctcttccatctcattcaaaaggcatggcagaatgaaaacgag
cgtgtgcaggagaagctcttgagcctgatcggtaggataggtcgagatgccaggagtcct
aaaaccacctgcaaggtcctggaactgctctgggacctggcccacttaccagccattcct
aagaaccacatggaacatgccttagaggaacacctctttatcctgagtgactctctagct
gttggaatgcaaatcaagaacaaatacgttgcaaagtgtgtggaagatatcaagagggta
agaacattaattttgttgtagtttaatgaaaacaaatttgtattcgtagtaccagccctg
agacagattcaccagatagccaagggtatcaccaaacagagctacagcaagactgataag
agtttacctcaggagctgaacaagacttatgacatcatcaagctgaccacacagagtctc
atgaagtgtcataagatggctatcaatgcagctgggcaggatggcttgtctggtagtact
atagtggatggcaagtacacacattgtgagcatgttgagatccatctgaaattccttgca
ttcattctacaagagggcgccctctatctccagtggcatcgagcgagggagatctgggat
acgttggtagcgaacccagaagcttgtgaggcagacagagagacatgctatgagtggttc
cgtcatggtctagcggacctggagacagagacacagatgcagctcttcaaggataagcta
ctcagactagaatcaacccacctctcacccatgggctttgactgtgtacgagcgttcttt
gagtctatcaacacaaacaatcacagtctacgcaagggtgctacaggactgattgttgag
aagctggacctgtttggccttgatttcatgtggaagatggttctagagtctaccaacgag
tccattgctgagatggctatcagacagatcatgagcatgtcttataccaatctagctcag
agacttaaaaaggatgtgcttgatcttcataagcatttcatctcagagtgttacaaacgt
ctggagctggcgtacatggcagtcaaaggtacagccatggcagaggctgttgctatggca
actaagacgttgacagcagtatccgtgcccgaggcagccattgtaccatgtccatcaagg
gcgggtaagctgctggaaatcgagagacttctgcagctagctgagacctacgttgtgact
gttgaagatcagttcacatcaccacgcacaatccttccacatggtgcatccttccagggt
catactatcacaatgcatgtcacatgtacagactcacatcgtagtgagtttgtcatagtg
ggtcacagcaatgaaacattacagagtgtaagacacaagatagcacagcgtctcaagaca
acactagacaatgtacagatcatggcccatgatcgcctgatgcttactaccaaggatcag
aagctgttatctgaactggagtttgatgaggagcaagatcttaacatcaagcttcatgga
ccggtcagctcaacggtcagcagtagtgcccgcatcgatgagaacatgtcaagttttgga
cagcagtctgagctggagcgttcgttacctggtgtcgtcatggcaactggtggtcaagtc
tttgacatgctctatcaaactgccgatatagatgaaccaaggataacagagagagttcgc
aaacttctcatgatgattcccacggatccatcgataccggaatcattggattctatatgt
agacaggttctgagtagcaagctgatgccttcgatgcaggaagacatcggtacccaaacc
agcgcacagaacttcagagagagcttcttaaatgcaggaggtctgagtctagtcatcaat
gccttgcagaaagattccattccacaagannnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnncaagacagatcaatgaaacattacagagtgtaagacacaag
atagcacagcgtctcaagacaacactagacaatgtacagattatggcccatgatcgcctg
gaaagtgatctgtcactcaatgacagcagtgtctttgataactctggagcagattcatct
actgtcttctcatctagctatggaagctcacctcgtaagatgagtctgttagaaagaata
tccagcgtagaggccagtggggatctagcaaatagagagggcacttcggtggcaatcacc
gtcattcagactatgaatgccaatgacttcacatcgatgatcgcctgtctaatgcgtgta
acctgggcagctgctgcaggtcagctaagattagccagcgctagtcaacccatcaaggag
gtggccggtggggggtttgctatgggcattggtagaaggagtaggcatagcagtgcaggg
agtacaaacagttcatccagtcatgatagtgagtcgcaggttttacatgcagggatctgt
ctcaatactacggctgtcagtgggaaagatgcagccatagccagggaagctctggaacta
cttgtagcttgtctccagcttaggacacataacctaggtgccttatataccctgcctgga
gtgaatgacttcatcatcgacatcctcctctcctcgccccaccctgaggtgaggggtgca
gccctggaccagttctacaccctcacctccaccagcatcagtaacgagagcgtgaggatc
ctgcatcctcgggactttgtgctccaggtcctcctccaggcccgagtgcctctctggacc
tccagctcactggttagaggagctaaccaaagaatactgaaccagtccgcacagtacttt
gagttgagatgccgtcttctggagggattgagggtgaatgagcagaagttcttgaaggtc
aacatcgtgtccatgcttggtgatgagatcgactggttacataactttgagcctggagac
tctgaggatatgaacctatctagtacagataacaccatcgtagcaggtcatcttcatctt
atcaggacgctactcacatgtgagggggtcgacaagaggaaaataggtgagagactactg
aacagtctactgaacgagtacctcttccctgcatcacgtctcgtcatgcatcaaggagat
aacagtgagaaaggagactcgagaagagactacaattcaaagatatctggcaaagaatca
cgtgtagcagcctttgagctacttgtagtactgtgtgagggctgtccatacaatctacag
aggattgcatcacagctcattaatatgcatcatcaactggacccttccattgccaaagag
tgggagttcttgccaccagtagaaggtaggatgaccaagtatgttggtgtgaagaacgga
ggtgctacatgctacatgaacgctgttatccagcagctgtatatgactccaggcatcagg
gagggtatccttgctggccacacccctgagaaagagaagggagaggacaccatcttctat
cagatgcagaatgtctttggccacctcctggagagcaagctacagtactatgaaccagag
aggttctggcaggtcttcaagttctggggagaaccagtcaacgtcagggagcagcaagat
gcctttgattttttcacgatactcaccgatcagctggatgagtacctcaagaaatccggt
cagaaagaggtgatgaaacaaaaattccagggtctctatctcaatcagatgatatgtcaa
gactgccctcataggaaagagagggaagaagaattctttgccctgaacctgactgtcaag
tcaaacaatctcaacgattctttagagcagtttgtgagaggagagatgttggaaggggag
aatgcttatctatgtgaagagtgcaatgaaaagggtatccttgctggccacacccctgag
aaagagaagggagaggacaccatcttctatcagatgcagaatgtctttggccacctcctg
gagagcaagctacagtactatgaaccagagaggttctggcaggtcttcaagttctgggga
gaaccagtcaacgtcagggagcagcaagatgcctttgattttttcacgatactcaccgat
cagctggatgagtacctcaagtttccctgggtgttagacatggagccgttcacttccaag
ggcatggctcgtagagagcagcagcagcagcaggccgatgatccacccagccctatgaac
taccagagacacgtctcctctcagagctctaccgatgatctctaccagctggtgggagtg
gtcgttcacagcggacaagccaacgctggtcactactactcattcatcaaggatagaggt
ctaacgttatgttttccctgggtgttagacatggagccgttcacttccaagggtatggct
cgtagagagcagcagcagcagcaggccgatgatccgcccagccctatgaactacctgaga
cacgtctcctcccagagctctaccgatgatctctaccagctggtgggtgtggtcgttcac
agcgggcaagccaacgctggtcattactactccttcatcaaggacagaggaggtacgtcc
atgaccaacatgagtaaggggaagtggttccgcttcaacgannnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntcttgtgtcccctgagtggttcatacgga
cctgagaacagattgagaacatggagtggttacatgttgttctatgagaagatggagggg
atgagaagccctgaccctatggctaggataggacgcaagggataccatggtgatatacac
gggagtatggatggtctgagttcccctgaactgtcccctacaggagacaggatgagtgag
ctctcagccctggttcacaagggtgagaagagaggcttcttcttggataagatgcctgca
ccaatccagagacaaatagaggatgagaacctacagttcttgaagaacagggccgtctac
aaccaggagtacatcacctttgtccgcaagctggcatcctgcagtttgcatatgacatac
catccagcatacagtatgatggcccagcagagtatcaagcttgccatgcactttgttctc
aacactctcttcagaacaaagaagaaactccggtatgatttagaggactggagagatctg
attgatagcatagtgaaagacagtccggaagcttgtgaatgggccctggaagtcttggca
tcatcacaaggcagagactacctcaaggccttcctactagaatgtcccagtcaagaggtt
cggatggctatggctaacatcgtcaagagtgtcatgcagagcttcgtcctgcgatcccat
gacacgcaccaagccaacctggatttcatccttgagcatctcctgtctctcctggacaag
gaggtcctggagcactgcaggagttgtgtccagtacttctggctcctcagcatgtacctg
gagctgggttcagatacctgtgagcacctgttcaggaggaaagctttccagagactcatc
acattcctcataggacccccttcagagctgaatgacttggacatccagacgagacggtgg
acatcacttcagactagagagtttggtttcctgcacaccatgcttgctgccatggttcta
cactcagatgtatctccatactggtctgttgaccttggtgacaagcctaagaggagaccc
atcttgatcctagagaacctgaacagattattaccagtgccagaagatatgagacatact
ctgtttggtcctccatgcctcaagtatatcaaggagtctgtgctagcattccgtgaagtt
cattcctcgaccacacccattcttgatatgttgctacattgtagcttctgcaatgaagga
ttcacattcaatgtcatgatgatcatacatagtcaagtatcgtctgctccagccaatgag
ctgaaggctatctttgtgctgctattagagctactgctactagatgatcctctacagcta
ataagattgaagctggccatggaaggcaatgaaagcaatggactcttcagtatcatccgt
aactgtacgggcaatgacagccggcggtcctaccagtgcatcaagttcttggtccatctg
tccaacaagtcaccagcagccaaggaatacctgacatcggtctcccagaagtggcactgg
gcagtcaactggctcaagaagaagatgacagagcactactggaaccctcagagttccatc
tccaacgagtcgtccaccagcaagggtttccaacgcaccatgagcgctcaggacaccctg
gccgaagccaccgctctcctcaccgatctcaccacgcaggatgaagacgaggatgatgat
gctatcaccaaggaggaggatgagggagaagagaccacagagggcaccgtcactcccagg
atggaggtcaacgggtcgtcggaagggtcagaggtcaatggaaacggcggtggggagaag
ccgacggaaaagataagcgggatagacgatgtggatggatag

DBGET integrated database retrieval system