KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0284Help
Entry
SPG_0284          CDS       T00734                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SPG_0284
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SPG_0284
Enzymes [BR:spx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SPG_0284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(274284..274760)
Genome map
AA seq 158 aa AA seqDB search
MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGLQELYERYQDQGFEIL
DFPCNQFMGQAPGSAEEINAFCSLHFQTTFPRFAKIKVNGKEADPLYVWLKDQKSGPLGK
RVEWNFAKFLIGRDGQVFERFSSKTDPKQIEEAIQTLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacttcactttatgatttttccgttttgaaccaaaacaaccaagcaactcccttggat
agctatcgtggcaaagttctcttgattgtcaacactgctactggatgtggtttaacgccc
cagtaccagggacttcaagaactctatgaacgctatcaagatcagggctttgaaatattg
gatttcccttgcaatcagtttatgggacaagcacccggcagcgcagaggaaatcaacgcc
ttctgtagcctacattttcaaaccaccttcccacgttttgccaagattaaggtcaacggt
aaggaagcagaccctctctatgtctggttaaaagaccagaaatccggcccactaggaaaa
cgagtcgaatggaatttcgctaagtttctcatcggtcgagatgggcaagtctttgaacgc
ttttcttcaaaaacagacccaaaacaaattgaagaggcgatacaaactctactataa

DBGET integrated database retrieval system