KEGG   Streptomyces rapamycinicus: M271_35280Help
Entry
M271_35280        CDS       T02907                                 

Definition
glycosidase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
src  Streptomyces rapamycinicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M271_35280
Enzymes [BR:src01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     M271_35280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8660748..8662136
Genome map
AA seq 462 aa AA seqDB search
MASSRIPLATALALAASAVTLVALPQTARATPPGTKDVTAELFEWKYDSVAKECTSTLGP
AGYGYVEVSPATEHIQGGQWWTSYQPVSYKIAGRLGDRTAFKNMIDTCHAAGVKVVADAV
INHMSAGSGTGTGGSSYTKYDYPGIYQPQDMDDCTAQISNYQDRWNVQHCELVGLADLDT
GEQYVRTRLAQYLNDLLSLGVDGFRVDGAKHIPADDLAAIKSQLSDPGVYWKQEVIYGEG
EAVSPTEYLRNGDVQEFRYGRDLKRVFQSEKLAYLKNFGEGWGYMASGQSGVFVDNWDTE
RNGSTLTYKNGADYTLANVFMLAWPYGSPDVHSGYEFSDNDAGPPNGGAAGACYQDGWKC
QHKWPEIMSMVALRNTARGASVTNWWDNGNNAIAFGRGDKAYVAINHESGPLTRTFQTSL
PAGGYCDVQSGKSVTVDSSGRFTATLGANTAVALHTGARSCG
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagccgcataccccttgccaccgcgctcgccctcgcggcgagcgcggtgacg
ctcgtcgcactgccccagaccgcgcgggcgacaccgcccggcaccaaggacgtcaccgcc
gaactcttcgagtggaagtacgactccgtcgccaaggagtgcaccagcaccctcggcccc
gccgggtacggctatgtcgaggtgtccccggccaccgagcacatccagggcggccagtgg
tggacctcctaccagcccgtcagctacaagatcgccggacggctcggcgaccgcaccgcc
ttcaagaacatgatcgacacctgtcacgcggcgggcgtgaaggtggtggccgacgccgtc
atcaaccacatgtcggccggatccggcaccggcaccggcggctcctcgtacaccaagtac
gactaccccgggatctaccagccccaggacatggacgactgcaccgcgcagatcagcaac
taccaggaccgctggaatgtgcagcactgcgagctggtgggcctcgccgacctggacacc
ggtgaacagtacgtccgcacccggctcgcgcagtacctcaacgacctgctctcgctcggc
gtggacggcttccgcgtcgacggcgccaagcacatcccggcggacgatctggccgccatc
aagagccagttgagcgaccccggcgtctactggaagcaggaggtcatctacggcgagggg
gaggcggtctccccgacggagtatctgcgcaacggcgatgtgcaggagttccgctacggc
cgtgacctcaagcgggtgttccagagcgagaagctcgcgtatctgaagaacttcggcgag
ggctggggctatatggcgagtggccagtccggtgtcttcgtcgacaactgggacaccgag
cgcaacggctccaccctcacctacaagaacggcgccgactacaccctggccaacgtcttc
atgctggcctggccgtacggctccccggacgtccactccggctacgagttcagcgacaac
gacgcgggcccgcccaacggcggcgcggcgggcgcctgctaccaggacggctggaagtgc
cagcacaaatggcccgagatcatgagcatggtcgccctccgcaacacggcccggggcgct
tcggtgaccaactggtgggacaacggcaacaacgccatcgcgttcggccgcggcgacaag
gcatacgtggccatcaaccacgagagcggccccctcacccggaccttccagacctcgctc
ccggcgggcggctactgcgacgtccagagcggcaagtccgtcacggtcgactcctcgggc
cggttcaccgccacgctgggcgcgaacacggcggtggccctgcacacgggcgcccgtagc
tgcgggtag

DBGET integrated database retrieval system