KEGG   Selenomonas ruminantium: SELR_01480Help
Entry
SELR_01480        CDS       T01799                                 

Definition
(GenBank) putative aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sri  Selenomonas ruminantium
Pathway
sri00010  Glycolysis / Gluconeogenesis
sri00052  Galactose metabolism
sri01100  Metabolic pathways
sri01110  Biosynthesis of secondary metabolites
sri01120  Microbial metabolism in diverse environments
sri01130  Biosynthesis of antibiotics
Module
sri_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELR_01480
   00052 Galactose metabolism
    SELR_01480
Enzymes [BR:sri01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SELR_01480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAL81856
UniProt: I0GM69
Position
175770..176897
Genome map
AA seq 375 aa AA seqDB search
MATVKQESFGKLSDGQEVFLYTLRNTKGTEVKITNYGARLVSWRVFGKDAKKIDILLGYA
DAAAYEKDDTSMGGLVGRHANRIAGGKAVINGQEYQLDLNDGSRMQNHIHGGSKGFHNEL
WQAEEIYEGIKLTYHSKDGDGGYPGNMDVTVIYSLSNDNELSIKYEAVSDKDTICNLTNH
SYFNLDGFASPSILDQKIQIFADQYTWADSESLPDGRILPVEGTPMDLRQPVRIGEHIDD
DFDELVMGKGYDHNWVLRDEPVHVEMKPGMFGYDPHCPIDYQKRGLKKAAYAESDQSGLT
LTCYTTLPGVQFYTGNFLDGSLPGKDGVTFPRRSGFCLETQYFPNSLANPAFPQPVIKAG
EKWEAQTIFVLFPKD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagttaagcaagaatcttttggcaaattgagtgatgggcaggaggtattcctt
tacacattgcgcaataccaaaggcacggaagtaaagattaccaactacggtgcacggctg
gtgagctggcgggtttttggcaaggatgcaaagaagatagatattctgttgggttatgcg
gatgccgctgcttatgaaaaggatgataccagcatggggggcttagtgggacgtcatgcg
aaccgcattgctggtggcaaggctgtcatcaacggacaggagtaccagctggatctcaat
gacggttccaggatgcagaaccatatccatggtggttccaaaggcttccataatgaactt
tggcaggctgaggaaatctatgaggggataaaacttacctatcatagcaaggatggtgat
ggagggtatcctggcaatatggatgtaaccgttatctattccttgtccaacgataatgag
ctgtcaatcaaatatgaagctgtcagtgataaggataccatctgcaatctgaccaatcat
agttatttcaatctggatggttttgcgtcgccgtccattctcgaccagaaaatccagatc
tttgccgatcagtatacctgggctgacagcgaatccctgcctgatggacggatcctgccg
gttgagggcacgccgatggatttgcggcagccggtacgcatcggtgagcatattgatgat
gattttgatgaactggttatgggtaaagggtatgaccataactgggtattgcgggatgaa
ccggtgcatgtggagatgaaaccggggatgttcggctatgatccccattgcccgattgat
tatcagaaaagggggctcaagaaggctgcttatgcggaatcggaccagagcggcctgacc
ctgacttgctataccaccttgccgggagttcagttctacacgggcaacttcctggatggc
agcctgccaggcaaagatggtgtgaccttcccacgccgttccggtttctgcctggaaact
cagtatttccccaattccctggccaatcccgctttcccgcagcctgtgatcaaagcgggt
gaaaagtgggaagcgcagacgatatttgtgttgttcccgaaggattga

DBGET integrated database retrieval system