KEGG   Selenomonas ruminantium: SELR_03440Help
Entry
SELR_03440        CDS       T01799                                 

Gene name
est
Definition
putative carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sri  Selenomonas ruminantium
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
386418..387152
Genome map
AA seq 244 aa AA seqDB search
MILPGAEPFFMPGGKKGVLLIHGFTGLPAELLLLGQHLNKAGFTVLGVRLAGHGTTVEDM
SHMTWEDWMDSVRDGYALLSGFCEDISVIGHSMGGLFALLLSTEEVISHVVTLAAPIFIP
EERGLAALPPREACYDGYVSKPRRRLKDVPPAANRTYRKMPLISIHELVEVIEKTKGAIE
EVKAPTLIMHSRDDHTAAPVSADYILSHVQGQARIVWLEESGHLLPLAGERERVFEEAAA
FLQG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgattttaccgggagcggagcccttttttatgcccggcgggaaaaaaggggtgctcctg
attcacggctttacaggcctgccggcagagcttttgctgctggggcagcatctgaataaa
gcgggctttacggtgctgggggtgcgtctggccggtcatgggacgacggtggaagatatg
agccatatgacctgggaagactggatggattccgtgcgggatggctatgccctgctgtcg
ggcttctgtgaagatatttcggtgatcgggcattccatgggcgggctctttgctttgctg
ctttccacggaggaggtcatctcccatgtggtgacgctggcggcaccgatcttcatcccc
gaagagagaggcctggcggcactgccgccgcgggaagcctgctatgacggctatgtgtcc
aagccacggcggcggctcaaggatgtaccccctgccgccaatcgtacctatcgcaagatg
ccgctgatttccatccatgagctggtggaggttatcgaaaagaccaagggtgctatcgaa
gaggtgaaagcaccgacgctgatcatgcacagccgcgacgaccatacggcggcgcctgtg
agtgcggattatattctgtcccatgtgcagggacaggcgcgcatcgtctggctggaggaa
tccgggcatctgctgcccctggccggcgaaagagagagagtatttgaagaggctgcggcc
ttcctgcaagggtag

DBGET integrated database retrieval system