KEGG   Serratia sp. AS12: SerAS12_4777Help
Entry
SerAS12_4777      CDS       T01502                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
srs  Serratia sp. AS12
Pathway
srs00220  Arginine biosynthesis
srs00330  Arginine and proline metabolism
srs01100  Metabolic pathways
srs01110  Biosynthesis of secondary metabolites
srs01130  Biosynthesis of antibiotics
srs01230  Biosynthesis of amino acids
Module
srs_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SerAS12_4777
   00330 Arginine and proline metabolism
    SerAS12_4777
Enzymes [BR:srs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SerAS12_4777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEF52822
JGI: SerAS12_4777
Position
complement(5155937..5156842)
Genome map
AA seq 301 aa AA seqDB search
MHIILAPTNLGLSPLRPGHVPGTWRAPQALMAQGLAQRLGAGAVTELPQLIYSPAAQPGT
RIRNGHAIRAFTLALAAEVAAAQAHGEFPLVVGGDCSILLGALAGSRSAGPLSLVHIDGH
SDFRHPGNYDPQQMLGAVAGMDLALATGRGEPLLTEWPGVAGPLVPERQVLQLGERECRD
ADFAWPDINQTAIARIDVFAANRMGKAEIVRQIEQMLATEPEWRFWLHLDVDVLDQTIMP
AVDSPGGPGIDRLWLENIVARLLQNPLCCGMTLSVFDPELDPDGRYAALIVEMLEAMFRS
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcattcttgcacctaccaatctggggctgagccccttgcgaccgggccatgtt
cccggaacctggcgagcgccgcaggcgctgatggcacagggtttggcgcaaaggttggga
gcgggggccgtcaccgagttgccgcaactgatctattcgccggcagcgcagcccggtacc
cgcatacgtaatggtcatgcgattcgcgccttcactctcgcgttggccgcagaggttgct
gcggcgcaggcgcacggcgagttcccgctggtggtcggcggcgattgttcgattctgctg
ggggcgctagccggttcacgcagtgcggggccgctttcgctggtacacatcgacgggcac
agcgatttccgtcatcccggcaactatgatccgcagcagatgttgggtgcggtggcgggg
atggatttggcgttggcgaccgggcgcggggaaccgctgctgaccgaatggcctggcgta
gcagggccgttggtgccggagcggcaggttttacagctgggcgagcgtgagtgccgggac
gcggattttgcctggccggatatcaatcaaacggcaattgcgcgcattgacgtcttcgcc
gccaaccggatgggcaaagcggaaattgtgcggcaaatcgaacagatgctggccaccgag
ccggaatggcgcttttggctgcatctggatgtggacgtgctcgatcaaaccattatgccg
gcggtggattcccccggtggccccggaatcgatcgcctctggctggaaaatatcgtggcg
cggttgctgcaaaatccgttgtgctgcggcatgacgctgtcggtattcgaccccgagctc
gatcccgacggccggtacgcggcgctgatagtggaaatgctggaggcgatgttccgctcc
cgctga

DBGET integrated database retrieval system