KEGG   Segniliparus rotundus: Srot_2821Help
Entry
Srot_2821         CDS       T01238                                 

Definition
family 3 glycoside hydrolase domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
srt  Segniliparus rotundus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Srot_2821
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Srot_2821
Enzymes [BR:srt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Srot_2821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2920681..2921925
Genome map
AA seq 414 aa AA seqDB search
MPALAHKFHALAASAALAAAALVPLPAHADPAGSCALGGMTTRQKLAQLLMPGVTGAQDM
RDVVAREQVGGVFIGSMTSHALLSSGQIGEISASAGAPLLVSIDEEGGRVSRIPDLIGQA
PSARTLAQTKTPEQVRAFAADRGRQLRALGVTADFAPDADVFAGDADTVIGDRSFSGDPH
TAAEYAEAYAQGLRDGGVLPVVKHFPGHGRASGDSHQGSVTTPDLADLQDFDLVPFREIV
GRLGSGTAVMVGHLTVPGLTEPGLPTSLSPATYRLLREGSGYGAAGFDGLVFTDDLSGMK
AVSSRYDVPHAVAAALEAGADVALWLSTSQVSAVLDTLEHEVASGAFPIARVEASVGRVL
AAKGVRAGTCGVGQARPAAPEEPGHDPELTDEPTEDEDAPAADEAPAEDARPVE
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctttggcccacaagttccacgcgttggcggcttcggctgcgctcgccgccgcc
gcgctcgtgccgctgcctgcccacgccgaccctgccggctcctgcgcgctcggcgggatg
acgacccggcaaaagctcgcgcagctgctcatgcctggcgtgaccggggcgcaggacatg
cgcgatgtggtggcccgagaacaggtcggcggggtgttcatcggcagcatgaccagtcac
gcgctgctttcctccggccagatcggcgagatctccgcatccgctggggcgccgctgctc
gtgtccatcgacgaggaaggcgggcgggtgtcccgcatcccggacctgatcggccaggca
ccctcggctcggacgctcgcccagacgaaaacacccgagcaggtgcgcgccttcgccgcc
gaccgtggccgtcagctgcgggctcttggggtcacagccgacttcgcgcccgacgcggac
gtgttcgccggggacgcggacaccgtcatcggggaccgctcgttcagcggcgacccgcac
accgccgccgaatacgccgaggcgtacgcgcagggcctgcgcgacggcggggtcctgccg
gtggtcaaacacttccccggccacggccgggcttccggcgactcgcaccaaggctcagtc
accactcccgacctggcggatctgcaagacttcgacctggtgccgttccgtgagatcgtc
gggcggctcgggtctgggacggcagtgatggtcgggcatctgacggtgccggggctcacg
gagccgggtctgccgacaagcctgtccccggccacgtaccgtttgctccgggagggttcc
ggctacggggcggctgggtttgacggccttgtgttcaccgacgatctttccggtatgaaa
gccgtctcgtcccggtacgatgtgccgcacgcggtggcggccgcgttggaggcgggggcg
gatgtggcgttgtggctgtccacctcgcaggtgtccgctgtcctggacacccttgagcac
gaggtggcctcgggggcgttccccatcgccagggtcgaagcttcggtcggcagagtcctt
gccgccaagggcgtgcgggcgggaacctgcggcgtggggcaagcccggccggctgctcct
gaggagcctgggcacgaccctgagctgacggacgagccgaccgaggacgaggacgcgcca
gcggcggacgaagcgccagcagaggacgcgcggcccgtcgaatga

DBGET integrated database retrieval system