KEGG   Sus scrofa (pig): 100153912Help
Entry
100153912         CDS       T01009                                 

Gene name
SMUG1
Definition
single-strand-selective monofunctional uracil-DNA glycosylase 1
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
ssc  Sus scrofa (pig)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ssc03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 272 aa AA seqDB search
MAVPQAFPLGPLHEPAGALMEPQPSPRSLAEGFLEEELRLNGELKQLQFSEPVGLIYNPV
EYAWEPHRSYVTRYCQGPKQVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIGGSVLTPP
QEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFRHCFVHNLCPLLLLAPSGRNLT
PAELPAKQREQLLGVCDAALCRQVQLLGVRLVVGVGRVAEQRARRALAGLMPEVQVEGLL
HPSPRSPQANKGWEAVAKERLNELGLLPLLTK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgccccaggctttcccactggggcccctccacgaacctgcaggcgcccttatg
gagccccagccctcccctcgaagtttggctgagggcttcctggaggaggagctccggctt
aatggtgagctgaagcaactacagttttccgagcctgtgggcctcatctacaatcctgtg
gagtacgcctgggagccacatcgcagctacgtcacccgctactgccagggccccaagcaa
gtgctcttcttgggcatgaacccaggaccctttggcatggcccagactggggtgcccttt
ggggaagtgagtatggtccgggactggttaggcatcgggggctctgtgctgacccctccc
caagagcaccccaagcgaccagtgctgggactggagtgccctcagtccgaggtaagtggt
gcccggttctggggctttttccggaacctctgtggacagcccgaggtcttcttccgtcac
tgtttcgtccacaacctgtgtcctctgctcctcctggcccccagtgggcgcaatctcacc
cctgccgaactgccggccaagcagcgagaacagctcctcggggtgtgtgacgcagcgctt
tgccggcaggtgcagctgctgggggtgcggctggtggtgggcgtggggcgcgtggccgag
cagcgggcacggcgggctctggccggcctgatgcctgaggtccaggtggaggggctcctg
cacccctcccctcgtagcccacaggccaacaagggctgggaggcagtggccaaggagaga
ctgaatgagctggggctgctgccgctgctgacgaaatga

DBGET integrated database retrieval system