KEGG   Sus scrofa (pig): 100157327Help
Entry
100157327         CDS       T01009                                 

Gene name
HIST1H2BD
Definition
histone cluster 1, H2bd
Orthology
K11252  
histone H2B
Organism
ssc  Sus scrofa (pig)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100157327 (HIST1H2BD)
  Immune diseases
   05322 Systemic lupus erythematosus
    100157327 (HIST1H2BD)
  Substance dependence
   05034 Alcoholism
    100157327 (HIST1H2BD)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100157327 (HIST1H2BD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 126 aa AA seqDB search
MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacccaccaaatctgctcccgccccgaagaaggggtccaagaaagcggtgact
aaggcgcagaagaaggatggcaagaagcgaaagcgcagccgcaaggagagctactccgtg
tacgtgtacaaggtgctgaagcaggtccacccggacaccggcatctcgtccaaagccatg
ggcatcatgaactcctttgtcaacgacatcttcgagcgcatcgcgggtgaggcctcgcgg
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcactaaggccgtcacc
aagtacaccagctccaaataa

DBGET integrated database retrieval system