KEGG   Sus scrofa (pig): 100157327Help
Entry
100157327         CDS       T01009                                 

Gene name
HIST1H2BD
Definition
histone cluster 1, H2bd
Orthology
K11252  
histone H2B
Organism
ssc  Sus scrofa (pig)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:ssc05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:ssc05322]
Human Diseases; Substance dependence; Alcoholism [PATH:ssc05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 126 aa AA seqDB search
MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacccaccaaatctgctcccgccccgaagaaggggtccaagaaagcggtgact
aaggcgcagaagaaggatggcaagaagcgaaagcgcagccgcaaggagagctactccgtg
tacgtgtacaaggtgctgaagcaggtccacccggacaccggcatctcgtccaaagccatg
ggcatcatgaactcctttgtcaacgacatcttcgagcgcatcgcgggtgaggcctcgcgg
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcactaaggccgtcacc
aagtacaccagctccaaataa

DBGET integrated database retrieval system