KEGG   Sclerotinia sclerotiorum: SS1G_00989Help
Entry
SS1G_00989        CDS       T01071                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
ssl  Sclerotinia sclerotiorum
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 5494369
NCBI-ProteinID: XP_001598900
UniProt: A0A1D9PY88 A7E6R4
Position
Unknown
AA seq 108 aa AA seqDB search
MGFKPGDAKKGANLFKTRCAQCHTLGEGEGNKIGPNLHGLFGRQTGSVEGYSYTDANKQK
AITWDENTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDLIQHLKEETK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcaagccaggagacgcaaagaagggtgccaacctcttcaagaccagatgtgct
caatgccacactctcggcgagggtgagggaaataagattggccctaaccttcacggtctt
ttcggtcgtcaaaccggttccgtcgagggctactcatataccgatgccaacaagcaaaag
gctatcacatgggacgagaacacacttttcgaatatctcgagaacccaaagaaatatatc
cccggtaccaagatggctttcggtggattgaagaaggacaaggacaggaacgatttgatc
cagcacttgaaggaggagaccaagtag

DBGET integrated database retrieval system