KEGG   Sclerotinia sclerotiorum: SS1G_00989Help
Entry
SS1G_00989        CDS       T01071                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SS1G_00989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 108 aa AA seqDB search
MGFKPGDAKKGANLFKTRCAQCHTLGEGEGNKIGPNLHGLFGRQTGSVEGYSYTDANKQK
AITWDENTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDLIQHLKEETK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcaagccaggagacgcaaagaagggtgccaacctcttcaagaccagatgtgct
caatgccacactctcggcgagggtgagggaaataagattggccctaaccttcacggtctt
ttcggtcgtcaaaccggttccgtcgagggctactcatataccgatgccaacaagcaaaag
gctatcacatgggacgagaacacacttttcgaatatctcgagaacccaaagaaatatatc
cccggtaccaagatggctttcggtggattgaagaaggacaaggacaggaacgatttgatc
cagcacttgaaggaggagaccaagtag

DBGET integrated database retrieval system