KEGG   Sclerotinia sclerotiorum: SS1G_05493Help
Entry
SS1G_05493        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K10759  
tannase [EC:3.1.1.20]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.20  tannase
     SS1G_05493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 577 aa AA seqDB search
MRSSHVATAIASLPALVQSLSLTDICTPTYLAANFPAVDFYDGITLDPTSITAKMVTNAS
ASSVFYPNAVIDYCAVTFKYSHNGLNDSVLLTYWVPAPANFQNRYLSTGGGGYAINSETQ
SLAGGVEYGAVAGQTDGGFGIFQNNVIAQFLLANGTVNWQNVYMFGYNAIHEMSVIGKEF
TSTIFNMTAKNATLYSYYQGCSEGGREGFSQVQRFADQFDGAAIGAPAFRYAFQQVQHLY
SNVVEQTLDYYPPPCELQKIVNETIIACDPYDGKTDGVVSRTDLCTINFNISTLLGTPYS
CPAAAGGFFGGATPAQNGSISAKGLAVAQKILDGLHTTDGKRAYFSYTSSSTFTDALTSY
NPTSGQFGLDITSLGGSFVEVLLDLKNGSNLQSLEGVTYDTLHNWIQDGWNRYNDVLMTN
WPDLTPYKNSGGKIIHFHGESDFSIPTASSVRYYESVREVMNPGLSYNDSVAATNEFYRL
FLVPGGSHCAVNAAEPNGPWPQTNLQVLIDWVENGAAPVTLNATVLQGENIGTNQQICGW
PLRPFWTNNGTTMECRYEQESIDSWIYDLDAFDMPVY
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcttcacatgtcgcaactgccattgcttctctcccagctctggtacaatctctc
agtctgacagatatttgcacaccaacctatctcgcggctaactttccagctgtcgatttt
tatgatggaataactttagatccaacatcaatcacagctaagatggtgacaaacgcctcg
gcatcgagcgtgttttatcccaatgccgtcatcgattattgtgctgttacgttcaagtac
tctcacaatggtctgaacgacagtgttcttctaacatactgggttcctgcaccagcaaat
ttccaaaatcgttacctttctacaggcggtggtggatatgccatcaattcagagactcaa
tcattggctggaggagtggaatatggtgcggttgcaggtcaaactgatggtggttttgga
atctttcaaaataatgttattgcccaattccttcttgcgaacggaacagtaaattggcaa
aatgtttacatgtttggatataatgctattcatgaaatgagtgtcattggaaaggaattc
acttcgactatctttaatatgactgccaaaaatgctaccttgtattcttactatcaaggc
tgctccgaaggcggcagagaaggctttagtcaagttcaacgttttgcggatcaatttgat
ggagcggcaatcggtgcacccgctttcagatacgcattccaacaagtgcaacacctttat
tcgaacgtcgtggaacaaactttggattattacccaccaccttgtgaattgcagaagatt
gtcaatgagacaatcattgcttgcgatccttatgatggtaaaacagacggagtagtctcc
cgaacagatctttgcacgataaacttcaatatctcgactcttttgggcacaccatactct
tgccctgcagcagcaggaggattttttggtggtgcaacacctgcacaaaatgggtcaatc
tcggccaagggtctagctgtagcccagaaaatactcgacggtctccacaccactgatggc
aaacgcgcctatttctcatatacttcctcctccaccttcaccgacgcattgacatcttac
aaccccacgagcggtcaattcggtcttgatatcacttctcttggcggctcctttgtcgaa
gtcctcctcgatctcaaaaatggttctaacctccaatctcttgaaggagtgacatacgat
accctccataactggatccaagatggatggaaccgttataacgatgttctaatgaccaac
tggccagaccttactccttacaaaaattccggcggaaaaatcatccatttccacggcgaa
tccgacttcagtatccccactgcctcatctgttcgatactatgaatctgtgcgagaagtt
atgaacccgggactctcatacaatgattccgtggccgcaactaatgaattctatcgacta
ttcctcgtaccaggtggttcgcattgtgcggtcaatgcagccgaacctaatggaccatgg
ccacaaacaaatttgcaggttttgattgattgggtggaaaatggggcggctcctgttact
ttgaacgcgactgttttgcaaggagaaaacattgggacgaatcaacagatttgtgggtgg
cctttgagacccttctggacgaataatgggacgactatggaatgtcggtatgagcaggag
agtattgattcgtggatttatgatttggatgcttttgatatgccggtttattag

DBGET integrated database retrieval system