KEGG   Sphingobium sp. SYK-6: SLG_08590Help
Entry
SLG_08590         CDS       T01622                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SLG_08590 (glgB)
Enzymes [BR:ssy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SLG_08590 (glgB)
Exosome [BR:ssy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SLG_08590 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
911396..913549
Genome map
AA seq 717 aa AA seqDB search
MKPPKAAIEALLAGTHADPFSLLGVHEGPGGAHARVIVPGAESVEAHDLGGNPLGALGCA
DQRGLFEGPIAGGRQPIRYRARAGAAEWWLSDPYSFGPVLGPVDDLLMAEGTHFRLFDKL
GAHLISHEGAEGVHFAVWAPNAQRVALVGDFNDWDGRRHVMRRRADIGVWEIFIPDIGAW
HAYKYLIIGPDGTAQPLKADPYAFASELRPKTASLTYETGTHEWGDAAHRAHWASVDPRR
TPISIYEVHPGSWQRDESGWFLPWDELAARLIPYVVEMGFTHIEFLPISEHPYDPSWGYQ
TTGLYAPTARFGDPDGFARFVDGAHRAGVGVLLDWVPAHFPTDAHGLGRFDGTALYEHED
PRLGFHPDWNTAIYNFGRREVSSFLVNNALFWAERYHVDGLRVDAVASMLYRDYSRPADQ
WIPNQEGGRENWEAVAFLQAMNKAVYGAHSGIVTIAEESTAWPGVTHPVHDNGLGFGFKW
NMGFMHDTLSYLARDPAHRRYHHDEITFGLMYAYSENYVLPLSHDEVVHGKGSLLTKMAG
DDWQKFANLRAFYALMWGYPGKKLLFMGQEFAQRREWSEGRSLDWDLLDAPAHEGVRTLV
RDLNHLYRDLPALHERDCEADGFEWLIADDRDNSVFAWLRKAPGAPPVAIIANLTPRVLD
HYEVPLPLDGVWREMLNSDATIYGGKGVGNMGKVTAEHGRAVMTLPPLGTIMLLGEG
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
gtgaagccgcccaaagcggccattgaagccctgctcgcaggcacgcacgctgatcctttc
tcgcttctgggtgtccatgagggccccggcggcgcgcatgcgagggtcatcgtgccgggt
gccgagagcgtagaggcccatgaccttggcggtaacccgctgggtgcgctcggctgcgcc
gaccagcgcggcctcttcgaggggcccatagcgggcggccgccagcccattcgctaccgg
gcgcgggccggcgcggcggagtggtggctgagcgatccctacagcttcggcccggtgctg
ggaccggtcgatgacctgctcatggcggaaggcacgcattttcgcctgttcgacaagctg
ggcgcgcatctcatcagccatgaaggcgcggaaggggtgcatttcgccgtctgggccccc
aatgcccagcgtgtcgctctggtcggcgatttcaacgactgggatggccggcggcacgtc
atgcgccgccgcgccgacatcggggtgtgggaaatcttcatcccggatatcggcgcctgg
catgcctataaatatctcatcatcggtccggacggcaccgcacagccgctcaaggccgat
ccctacgctttcgcgtccgagttgcggccgaagacggcatcgctgacctacgagaccggc
acgcatgaatggggcgacgcggcgcatcgggcgcattgggcttcggtcgatccccgccgc
acgccgatcagcatctacgaggtccatccgggctcctggcagcgggacgagagcggctgg
ttcctgccatgggacgagctcgcggcccggctcattccctatgtcgtcgagatgggcttc
acgcacatcgagttcctgccgatctccgagcatccttatgacccaagctggggctaccag
accacgggtctctatgcgcccacggcgcggttcggcgatcccgacggttttgcgcgcttc
gtggacggggcacatcgggccggcgtgggcgttcttctcgactgggtgcccgcgcatttc
cccaccgacgcgcacgggcttggccggttcgacgggaccgcgctctacgagcatgaggat
ccgcgcctcggcttccatcccgactggaacacggccatctacaatttcgggcggcgggaa
gtctccagcttcctcgtcaacaacgcgctgttctgggccgagcgctaccatgtcgacggg
ctgcgcgtggatgccgtcgcgtccatgctctaccgggattacagccggcctgcggaccag
tggattcccaatcaggagggggggcgcgagaactgggaagcggtggctttcctccaggcg
atgaacaaggccgtctatggcgcgcattccggcatcgtgacgatcgccgaggaatcgacc
gcctggccgggcgtcacgcatcccgtccatgacaacggactgggtttcggcttcaagtgg
aacatggggttcatgcacgacacgctcagctatctggcgcgtgatccggcgcatcggcgc
tatcatcatgacgagatcacattcggtctgatgtacgcctatagcgagaactacgtgctg
ccgctcagccatgatgaagtggtgcacggcaagggctcgctgctcaccaagatggcgggc
gacgactggcagaaattcgcaaatctcagggccttctacgcgctgatgtggggatatccc
ggcaagaagctgctgttcatggggcaggagttcgcgcagcggcgggaatggagcgaaggg
cgttcgctcgactgggacttgctggatgcgcccgctcatgaaggtgtccgcacgctcgtg
cgtgatctcaatcatttgtaccgtgatcttcccgccctgcatgagcgggattgcgaggcg
gacgggttcgagtggctgatcgccgacgaccgggacaattcggttttcgcctggctccgc
aaggcgccgggcgctccgccggtggcgatcatcgccaatctgacgccccgggtgctggat
cattacgaagtgccgctgccgctggacggcgtctggcgcgaaatgcttaacagtgatgca
accatctatggcggaaaaggtgtcggcaacatgggcaaggtgacggccgaacatggccgg
gccgtcatgaccctgccgccgcttggaacgatcatgctgcttggtgagggatga

DBGET integrated database retrieval system