KEGG   Spirochaeta thermophila DSM 6192: STHERM_c13900Help
Entry
STHERM_c13900     CDS       T01315                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sta00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sta00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1504284..1505687)
Genome map
AA seq 467 aa AA seqDB search
MDLNEAVLYESSYVTGTRLTPLRPEERSPASVSGSPYIEREVVVDPSREYQRILGFGGAL
TEASGYVLSLLPDKERERVIRMYFDRREGHGYTFARTHMNSCDFSFGNWALVEKEDPSLS
SFDLGPSRRYQLPLVKDAWRVSGGLRLLVSPWSPPAWMKDNREMCHGGKLLPEYYPVWAR
YFVSFIRALQGEGLEVWGVTVQNEPEAVQTWESCIYTGEEEGRFVRDHLVPTFRGAGLEG
KKVLIWDHNRDRLPERVEESFGLEGVREVVDGVAYHWYSGPQYDNVEETSSRIDGKLLVF
TEGCIEGGARPGEWWVGERYGYEMIQDLLHGAKAWIDWNVVLDTEGGPNHAGNFCDAPVL
VDIEGKEVFPQSSYYYIGHLSRWCRPGSRRIEVTVPEAGDEDSSAGGRFWEQRDLALGVR
DPEGRIVLVLYNSRDVSIMYSVRRKGDRGEFRHVCPPHSIQTVILEA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggacttgaacgaggcagtgctctacgagtcttcgtatgtcacgggaacgcgtcttacc
cctctgcgtccagaagaacgcagtcctgcgtccgtgtcaggatcaccgtatatcgagcgg
gaggtggtggtcgatccctctcgggagtatcagcgcatactcggcttcggtggggcgctc
accgaggcatcaggatacgtgctttctctgttaccggacaaggagagggaacgggtgatc
cggatgtacttcgatcgaagggaggggcacgggtatacctttgcgaggacgcacatgaac
agctgtgacttctcgttcgggaactgggccttggtggagaaggaggacccctcactctct
tcgttcgacctgggtccttcccgacggtaccagcttccgctcgtgaaggatgcgtggagg
gtctcgggtggtcttcgtcttctcgtctccccctggagcccgccggcctggatgaaggac
aaccgtgagatgtgccacggggggaagctccttccggaatattaccccgtgtgggcgcgg
tactttgtctccttcatcagggctcttcaaggggaagggctcgaggtgtggggtgtgacg
gtccagaacgagcccgaggcggtgcagacatgggagtcgtgtatctacaccggtgaggag
gaaggacggttcgtcagggatcacctggtgcccacgttcaggggggccggcctggaaggg
aaaaaggtgctcatctgggaccacaacagggacaggcttccggaacgggtggaggagagc
ttcggactcgaaggggtgagggaggtggtggacggagtggcttatcactggtactccggt
ccgcagtatgataacgtggaggagacctcttctcgcatcgatggcaagctcctcgtgttc
accgagggatgcatcgagggaggggcgaggccgggtgagtggtgggtgggggagcggtac
ggctacgagatgatccaagacctcctccacggggccaaggcgtggatcgactggaatgtg
gtgctcgacacggaagggggtccgaatcacgcaggaaacttctgcgacgcaccggtgctc
gtggatatcgaggggaaggaggtcttcccccaatcctcgtactactacataggccacctc
tcacggtggtgtcgtcccgggagcaggaggattgaggtcaccgttcccgaggcaggggat
gaggattcatccgccggtggtcgcttctgggaacaacgggatctcgcattgggggtgcgg
gatcccgaggggaggatcgtgttggtcttgtacaattcgcgtgatgtctccatcatgtac
tcggttcgaaggaagggggaccgtggagaattccggcatgtctgtcctcctcattcgatc
cagaccgtgatcctggaggcctga

DBGET integrated database retrieval system