KEGG   Spiroplasma taiwanense: STAIW_v1c09590Help
Entry
STAIW_v1c09590    CDS       T02742                                 

Gene name
mutM
Definition
(GenBank) formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
stai  Spiroplasma taiwanense
Pathway
stai03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:stai00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    STAIW_v1c09590 (mutM)
Enzymes [BR:stai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     STAIW_v1c09590 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     STAIW_v1c09590 (mutM)
DNA repair and recombination proteins [BR:stai03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     STAIW_v1c09590 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS FbpA zinc-ribbons_6 TRAF_BIRC3_bd Ribosomal_S13 C1_1 IBR
Motif
Other DBs
NCBI-ProteinID: AGR41545
UniProt: S5MI28
Position
complement(933467..934300)
Genome map
AA seq 277 aa AA seqDB search
MPELPEVETVVRSLNKRIKGLTIKNVKITYPNLIKTNIEIKDFENILKERKIDNITRIAK
HIIFHFQDKVLISHLRMEGKWFIYENLIFLNQKHIEAIFELSNNSFLVYHDTRKFGTFHL
QNFDGYLQQNPINKVGPEPFQKDIDGQYFFNVMSKSSKYIKTVLLDQTKISGIGNIYADE
ILFHSKIHPESRALNLNLENYEKIFEASVKVLNRSIELGGSTIDTYQPEQGIDGKFQNEL
KVHTRKGKKCYDCKTIIDKIKVNGRGTYFCSNCQFLF
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagttgaaactgttgttagatctttaaataaaagaattaaaggt
ttaacaattaaaaatgtaaaaattacatatccaaatttaattaagactaatattgaaatt
aaggattttgaaaatattttaaaagaaagaaaaattgataatattactagaattgcaaaa
catattatttttcattttcaagataaagtattaataagtcatttaagaatggaaggtaaa
tgatttatttacgaaaatcttatttttttaaatcaaaaacacattgaagctatttttgaa
ttaagtaataattcttttttggtatatcatgacactcgaaaatttggaacttttcatttg
caaaattttgatggatatttgcaacaaaatccaataaataaagttggtcccgaacctttt
caaaaagatattgatggtcaatacttttttaatgttatgtctaaatcaagtaaatatata
aaaactgttttattagatcaaacaaaaatttcaggaattggtaatatatatgctgatgaa
atactatttcactcaaaaattcatccagaatcaagagctttaaatttaaatttagaaaat
tatgaaaaaatttttgaagcatctgtaaaagttttaaataggtctatagaattagggggc
tcaactattgatacctatcaaccagaacaaggaattgatggaaaatttcaaaatgagtta
aaagttcatactagaaaaggtaaaaaatgttatgattgtaaaactattattgataaaatc
aaagttaatggaagaggtacatatttttgctcaaattgccaatttttgttttaa

DBGET integrated database retrieval system