KEGG   Streptococcus thermophilus LMD-9: STER_1498Help
Entry
STER_1498         CDS       T00414                                 

Definition
hydroxymethylpterin pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STER_1498
Enzymes [BR:ste01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     STER_1498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1402332..1402823)
Genome map
AA seq 163 aa AA seqDB search
MTKVYLSLGSNMGNRQDYLKKAVESLDRLLETEVKAVSSYYETAAWGLTDQADFLNLALA
LDTQLPAESLLSACQAIEKDLDRVRHEHWGPRTVDIDILLYGQEIWGTEHLKVPHPLMTQ
RAFVLVPLLEIAENLVEPQTGQAYKKYLSQIDTSDVRKLEQVD
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtttatttaagtttgggatctaatatgggaaatcgtcaagactatcttaaa
aaagcggtggagtcattggatcgcttgcttgagacggaagttaaagcagtgtcctcttat
tatgagacggctgcttggggattaactgaccaggctgattttttgaatctcgctttagca
cttgacactcagttgccggctgaaagcttgctgagtgcttgtcaggcaattgagaaagat
ttagaccgcgttcgccatgagcattggggccctcgaactgtggatattgatattctttta
tatgggcaggaaatctgggggactgagcaccttaaagtgcctcatcctctcatgactcaa
agggcctttgttttggttcctctgctagaaattgccgagaatttagttgagcctcaaact
ggtcaagcctacaaaaaatatttgagtcaaatagacactagtgatgtccgcaaattggag
caagtggactag

DBGET integrated database retrieval system