KEGG   Streptococcus salivarius 57.I: Ssal_01581Help
Entry
Ssal_01581        CDS       T02088                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
stf  Streptococcus salivarius 57.I
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:stf00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:stf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1552167..1552712)
Genome map
AA seq 181 aa AA seqDB search
MLEWIVNLKRKGNTLSKQLIAIWAEARNHVIGKNHTMPWHLPAELAHFKKTTMGSAILMG
RVTFDGMNRRCLPGRETLILTRDEDFDCEGVTTVTSVEEALAWFEQQDKDLYIAGGAGVY
KAFDGHYDALIKTTIEADLEGDTYFPQLDMTAFKEVSHERVAKDDKNAYDFIISRYEKEG
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgttagaatggattgtaaacttaaaaagaaaaggaaatactttgtctaaacaactcatt
gctatttgggcggaagctcgtaaccatgttattgggaagaatcacaccatgccttggcat
ttgcctgctgaactggcacatttcaagaaaacgaccatgggctcagcaattctcatgggg
cgtgtgacctttgatggcatgaaccgtcgttgcctgccaggacgtgaaaccttgattttg
acacgagacgaggacttcgactgtgagggtgtaacgaccgttacgagtgttgaggaagcc
ctagcctggtttgaacagcaagataaggatctctatattgctggtggtgctggtgtctac
aaggcttttgatggacattatgatgcactcatcaagacaactattgaggctgatttagag
ggagacacgtattttccacaactagatatgacggcatttaaagaggtatcacacgaacgt
gtggccaaggatgataaaaatgcctacgactttatcataagtcgctatgaaaaagaagga
gactag

DBGET integrated database retrieval system