KEGG   Sphaerobacter thermophilus: Sthe_2293Help
Entry
Sthe_2293         CDS       T01128                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sti  Sphaerobacter thermophilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sti01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sti00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2548925..2549902
Genome map
AA seq 325 aa AA seqDB search
MESDRIREAVATTNRLKAGPIQPVCFPLALGAVRAGVELGAAALDDALRARLIRRGFPDL
LNRLRPAITIPAPQAGDEPLDGRRRPGEAMYLDEIAASMPPLASAVADAIRDGALALALG
GDHALSLGTLAGAAATAERLAVLWIDAHGDINTPETSPSGHVHGMPLAAALGRGPSVLTD
LFAETPPIRPEDTVMLGLRDLDPGERAWLAEGTIHYATMAHIDDRGLDATIADAIDRLRA
SGADAVHVSFDLDVLDPLLLPGTGTRVYGGLTFREAARLLRMLRDSDLPIRSLDWVELNP
ALDPSGGSTAVAAELLAIALGETTD
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtggagagcgacaggatccgcgaggccgttgccacgaccaaccgcctgaaggcggggccg
atccagccagtgtgcttcccgctggcgctcggcgccgtacgcgcgggggtcgagcttggc
gcggctgcgctggacgacgccctccgcgcgcgcctgatccgccgcgggttcccagacctg
ctcaaccgcctacgcccagccatcacgatcccggccccgcaagccggtgacgaaccgctt
gacggccgcaggcgcccgggcgaggccatgtacctcgacgagatcgccgcgtcgatgcca
ccgctcgcttcggccgtggcggacgccatccgcgacggcgcgctggcgctggcgctcggc
ggggaccacgcgctctccctcggcacactggccggcgccgccgccaccgccgagcggctg
gccgtcctctggatcgacgcccacggcgacatcaacacccccgagaccagcccctcgggc
catgtccacggcatgccgctggccgccgcgctcggccgcggcccgtcggtgctgaccgac
ctcttcgcggagacgccgccgatccgccccgaggacaccgtcatgctcggcctgcgcgat
ctcgaccccggcgagcgcgcctggctggccgaaggaaccattcactacgccacgatggca
cacatcgacgaccgcgggctggacgccaccatcgccgacgccatcgaccgcctccgcgcc
tccggcgccgacgccgtccacgtcagcttcgacctcgacgtgctcgacccgctgctgctg
ccggggaccggcacccgtgtgtacggcggcctgactttccgcgaggcagcgcgcctgctg
cgcatgctacgcgactccgacctgccgatccgctcgctcgactgggtggaactcaacccc
gccctcgacccctccggcggcagcactgccgtcgccgccgagctcctcgccatcgccctc
ggcgagacgacggactga

DBGET integrated database retrieval system