KEGG   Streptococcus parauberis: STP_0259Help
Entry
STP_0259          CDS       T01504                                 

Gene name
dlpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
stk  Streptococcus parauberis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:stk00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
277874..279385
Genome map
AA seq 503 aa AA seqDB search
MTEEKYIMAIDQGTTSSRAIIFNKKGEKIASSQKEFPQIFPQAGWVEHNANQIWNSVQSV
IAGAFIESSIKPGQIEAIGITNQRETTVVWDKATGLPIYNAIVWQSRQTAPIADQLKQDG
HIDLIHEKTGLVIDAYFSATKIRWILDHVPGAQERAEKGELLFGTIDTWLVWKLTDGAVH
VTDYSNAARTMLYNIKDLSWDDEILSILNIPKAMLPEVKSNSEIYGKTAPFHFYGGEIPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGEEMQLSENNLLTTIGYGINGKVY
YALEGSIFIAGSAIQWLRDGLRMIETSPESEELAKLSKSDDEIYVVPAFTGLGAPYWDSN
ARGSVFGLTRGTTKEDFVKATLQSIAYQVRDVIDTMQDESGIDIPQLRVDGGAAMNDLLM
QFQADILGIDIARAKNLETTALGAAFLAGLAVGYWEDLDSLKELNATGKLFKSSMNESRK
EKLYKGWKKAVKATQLFATDEDE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagaaaagtacattatggccatcgaccagggaactactagctcaagagctatt
attttcaacaaaaaaggcgagaaaattgctagtagccaaaaagagtttcctcaaatcttt
ccacaagcaggatgggtagaacacaatgctaaccaaatttggaattctgttcaatctgtt
attgcaggtgcttttattgaatcaagtatcaaacctggacaaattgaagcaatcggaatt
accaatcaacgtgaaacaacagttgtttgggacaaggcaacaggacttccgatttacaat
gctattgtttggcaatctcgacaaacagcgccaatcgcagatcaattaaaacaagatggt
catattgacttaattcatgaaaaaacaggtttggtcatcgatgcgtacttttcagcaaca
aagattagatggattctagaccatgtacccggggcgcaagaacgtgctgaaaaaggtgaa
ctattatttggtactattgatacttggttggtttggaaattaactgacggtgcggttcat
gtaacagattattctaatgcagctcgtactatgctttataatatcaaagatttatcgtgg
gatgatgagattctttctattttaaatattcctaaagcaatgttgccagaagttaaatca
aattcagaaatatatgggaaaacagctcctttccatttttatggtggagaaataccaatt
tcgggtatggctggggatcagcaagctgctttatttggacaattagcatttgaaccaggg
atggttaaaaacacatacggaactggttctttcattattatgaataccggtgaagagatg
caattatctgaaaataatctcttaacaacaattggttacggtattaatggtaaagtttat
tatgcattggaaggttcaatctttattgcgggaagtgcaattcaatggttacgtgatgga
ttacgtatgattgaaacctcacctgagtcagaagaattagccaaattatcaaaaagtgat
gatgagatttatgtagttccagcatttactgggctcggtgcaccatattgggattccaat
gcacgtggttcggtctttggcttgacacgtggtaccacaaaagaggactttgtcaaggca
acactgcaatctattgcctatcaagtccgtgatgttattgatactatgcaagatgaatct
ggaattgatattcctcaacttcgtgttgatgggggtgctgcaatgaatgatttactaatg
cagttccaagctgatattctcggaatcgatattgctagagcaaaaaatttagaaacaaca
gctctcggtgcagccttcctagcaggattggcggtaggttattgggaagatttagattct
ctgaaagaattaaatgcgactggtaagctcttcaaatcaagtatgaatgaatcaagaaaa
gaaaagttatacaagggatggaagaaagcagttaaagcaacacaattatttgctacagac
gaggatgaataa

DBGET integrated database retrieval system