KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM4081Help
Entry
STM4081           CDS       T00065                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00010  Glycolysis / Gluconeogenesis
stm00051  Fructose and mannose metabolism
stm00562  Inositol phosphate metabolism
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01120  Microbial metabolism in diverse environments
stm01130  Biosynthesis of antibiotics
stm01200  Carbon metabolism
stm01230  Biosynthesis of amino acids
Module
stm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stm_M00002  Glycolysis, core module involving three-carbon compounds
stm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STM4081 (tpiA)
   00051 Fructose and mannose metabolism
    STM4081 (tpiA)
   00562 Inositol phosphate metabolism
    STM4081 (tpiA)
Enzymes [BR:stm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     STM4081 (tpiA)
Exosome [BR:stm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   STM4081 (tpiA)
  Exosomal proteins of bladder cancer cells
   STM4081 (tpiA)
  Exosomal proteins of melanoma cells
   STM4081 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-GeneID: 1255608
NCBI-ProteinID: NP_462962
UniProt: Q8ZKP7
Position
complement(4290278..4291045)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRKELTGVAGCDVAIAPPEMYIDLAKRAAAGSHIM
LGAQNVDLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggtggctaacctgcgtaaagaactgacgggcgtagcaggctgcgacgtggcaatc
gctccgccggaaatgtatatcgatctggcgaaacgcgctgctgccggcagccacatcatg
ctgggcgcgcagaacgttgatctgaatctgtctggcgcattcaccggtgaaacttcggct
gaaatgctgaaggatatcggcgcgcagtacattattatcggccactccgagcgtcgtact
tatcacaaagaatctgacgagctgatcgccaaaaaattcgccgtactgaaagaacaaggt
ctgacgccggtactgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaacagaa
gaagtatgcgcacgccagatcgacgcggtactgaaaacgcagggcgcggcagcctttgaa
ggcgcggttatcgcttacgaacccgtatgggcgatcggtaccggtaaatctgcaactcct
gcgcaggcgcaggcagtgcacaaattcatccgtgaccacattgctaaagctgacgcgaaa
atcgctgaacaggttattatccagtacggcggttctgttaatgcctccaacgccgccgaa
ctgttcgcgcagccggacatcgacggcgcactggtaggcggcgcttctctgaaagctgac
gccttcgcggtgatcgtgaaagcagcagaagctgctaaacaggcttaa

DBGET integrated database retrieval system