KEGG   Salinispora tropica: Strop_0745Help
Entry
Strop_0745        CDS       T00504                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
stp  Salinispora tropica
Pathway
stp00040  Pentose and glucuronate interconversions
stp00052  Galactose metabolism
stp00500  Starch and sucrose metabolism
stp00520  Amino sugar and nucleotide sugar metabolism
stp01100  Metabolic pathways
stp01130  Biosynthesis of antibiotics
Module
stp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Strop_0745
   00052 Galactose metabolism
    Strop_0745
   00500 Starch and sucrose metabolism
    Strop_0745
   00520 Amino sugar and nucleotide sugar metabolism
    Strop_0745
Enzymes [BR:stp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Strop_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Smr IspD
Motif
Other DBs
NCBI-ProteinID: ABP53222
JGI: Stro0745
UniProt: A4X2X2
Position
826815..827771
Genome map
AA seq 318 aa AA seqDB search
MSEHSANPSSTATTTGGPRAVKAVIPAAGLATRFLPATKAVPKELLPVVDRPVLQYIVEE
ATEAGITDVLLITGRGKTSMVDHFDRRPDLEERLAKKPELLAAVKRTEDLAAIYTCRQPE
QLGLGHAVGYAESHIGDQPFAVLLGDEFVKPTEPLLPAMLELQARTGGIVLAFFEVDPDE
TTRYGIASVAPAEAEFADIAEVVRVTGMVEKPEPEEAPSNLAVLGRYVLPGRIFDAIHRT
EPGSGGEIQLTDAMEILRTEGVPVHAIVYRGTRYDTGMPLGYLQTVVQIAAERDDLGAEF
REWLADFVNAGSSGGPRT
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcactcagcgaacccttcatcgacggccaccacgaccggcgggccccgcgcg
gtcaaggcggtcattccggccgccgggctcgccacccgcttcctgcccgccaccaaggcg
gtgcccaaggaactgctccccgtcgtcgaccggccggtgttgcagtacatcgtcgaggag
gccaccgaggccgggatcaccgacgtcctgctgatcaccgggcggggtaagacctccatg
gttgatcacttcgaccgccgtcccgacctggaagaacggctcgcgaagaagcctgagctg
ctggccgcggtcaagcggaccgaggacctggccgccatctacacctgccggcagccggag
caactcgggctcggccacgccgtcggctacgccgagtcccacatcggagaccagcccttc
gcggtgctgctcggggacgagttcgtgaagccgaccgagccgttgctgccggccatgttg
gagctgcaggcccgtacgggcgggatcgtgctggctttcttcgaggtcgatcccgacgag
accacccggtacggcatcgcctcggtggcgccggccgaggcggagttcgccgacatcgcc
gaggtggtccgggtgaccggcatggtggagaagccggagccggaggaggcccccagcaat
ctcgccgtgttgggccgctacgtccttcccgggcgcatctttgacgcgatccaccggacc
gagccgggcagcggcggcgagatccaactgaccgacgcgatggagatcctgcgcaccgag
ggggtgccggtgcacgccatcgtctatcggggcacccggtacgacacgggcatgccgttg
ggctatctccagaccgtcgtgcagatcgccgcggaacgtgacgacctcggcgccgagttc
cgtgagtggctcgccgactttgtcaacgcgggctcttcgggtggtccacgtacatga

DBGET integrated database retrieval system