KEGG   Salinispora tropica: Strop_2611Help
Entry
Strop_2611        CDS       T00504                                 

Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
stp  Salinispora tropica
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Strop_2611
Enzymes [BR:stp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Strop_2611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2931245..2932876
Genome map
AA seq 543 aa AA seqDB search
MTGTSLSRRGLLRATTLGAGVAVAGVALGQQAAQAGGPVPALAGKTAVVIGSGFGGAVAA
YRLGQAGVVTTVLERGRRWDVDGSGNTFCSINEPDWRCGWFLDRPPLGINLGARIEQRAG
LIARHDGDGISVLSGTGVGGGSLAIGMFLPQPRRSEWEQVYPTEVGYDEMNDVYWPRARQ
RLGATPIPEDVQSTGPYRGARAWLDYLSEFKQTPLPIPFAVDWDVIRAELAGDTVPCHTI
GEGPYGSNSGAKNSVDRNYLAWAAATGNVTTLALHEVTEIHEVSGQDKFEIRCRQIDEHG
SVLSTKTFVCDYLFMAAGSVYTTSLLLTSQAKGWLPRLVNQEVGKGWGNNGDFLVTRINL
RKDVGYAQGGPGNVKYIDEDNPYAPTSMAWEAAPVPRWMPRTTAHLVTSMTPERGEIRYD
AATGAGKVHWPYGTLETTSEKAAVNLVTRLWWQTEGRKGYLLHGLPTYARGVGTGLGAAN
TWHPLGGMVMGKATDFDGRCVDYPNLFCIDGSLLPGSTCLANPSLTITANAERCMDRFVA
AHS
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtacgagcctttcccgacgtggcctgctaagggccaccacgctcggcgccggc
gtcgccgtcgctggggtcgcactaggccagcaggcggcccaggcgggtggtccggtaccc
gcgttggccgggaagaccgccgtggtcatcggcagtggcttcggcggggcggtcgccgct
taccgactcggccaggccggagtggtgaccacggtgttggaacgaggtcgccgctgggac
gtggacggctccggcaacacgttttgcagcatcaatgagcccgactggcggtgtggctgg
ttcctggaccgcccgccattgggaatcaacctcggcgcgaggatcgaacaacgggccggg
ttgatcgcccgacacgacggagatggaatctcggtgctgagcggaaccggagttggcggc
ggctccctcgccatcgggatgttcctaccgcagccgcggcgcagcgagtgggagcaggtg
tatccgaccgaggtcggatacgacgagatgaacgatgtctactggccacgggcccggcaa
cgcctcggtgcgacgccaattcccgaggatgtgcagagcaccggcccctaccggggagcc
cgagcctggctcgactacctgtccgagttcaagcagacccccctccccattccgttcgcc
gtcgactgggacgtgatccgcgccgagctcgccggtgacaccgtgccgtgccacacgatc
ggtgagggcccgtacggcagcaactccggggcgaagaacagcgtggaccgcaactacctc
gcctgggccgctgcgaccggcaacgtgaccacactggcgttgcacgaggtcaccgagatc
catgaggtgtccggtcaggacaagttcgagatccggtgccgacagatcgacgagcacggc
tcggtcctctccacgaagaccttcgtctgcgactacctgttcatggccgccggctccgtc
tacaccacctccctgctgctcacctcccaggccaagggctggcttccccgcctggtcaac
caggaggtgggcaagggctggggcaacaacggcgacttcctggtgacccggatcaacctg
cgaaaggacgtcggctacgcccagggcggtccgggtaacgtcaagtacatcgacgaggac
aacccgtacgcacccacctcgatggcgtgggaggcagcacctgtcccccgttggatgccg
cgtaccacggcgcacctggtgaccagcatgactccggaacgtggcgagattcgctacgac
gcggcgaccggggccggtaaggtgcactggccgtacgggacgctggagaccacctccgag
aaggcggcggtgaacctggttacccggttgtggtggcagaccgaaggccgcaagggatac
ctcctgcacggtctgccgacctacgcccggggtgtcggcaccgggctcggtgccgcgaac
acctggcatccgctgggcggcatggttatgggcaaggccaccgacttcgacggtcgatgc
gtcgactaccccaacctcttctgcatcgacggatcgctcctgccggggtcaacctgcctg
gcaaacccttcgctgaccatcaccgcgaacgccgaacgctgcatggaccggttcgtcgcc
gcgcactcctga

DBGET integrated database retrieval system