KEGG   Salinispora tropica: Strop_3650Help
Entry
Strop_3650        CDS       T00504                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
stp  Salinispora tropica
Pathway
stp00260  Glycine, serine and threonine metabolism
stp00750  Vitamin B6 metabolism
stp01100  Metabolic pathways
stp01110  Biosynthesis of secondary metabolites
stp01120  Microbial metabolism in diverse environments
stp01230  Biosynthesis of amino acids
Module
stp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Strop_3650
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Strop_3650
Enzymes [BR:stp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Strop_3650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABP56081
JGI: Stro3650
UniProt: A4XAY2
Position
complement(4182170..4183219)
Genome map
AA seq 349 aa AA seqDB search
MWRGLIDAYRDRLPVTATTPVVTLHEGNTPLLPAPVLSGRTGCEVYLKVEGANPTGSFKD
RGMTVAVSKAVEADNKVIICASTGNTSASAAAYAARAGLTCAVLVPQGKIALGKLAQALV
HGARLLQVSGNFDDCLSLAAKLAQDYPVALVNSVNIDRLHGQKTAAFEIVEALGAAPDIH
CMPVGNAGNISAYWLGYSEERAAGNIPQTPKLYGFQAAGAAPIVTGQAVREPATIATAIR
IGNPASWTRALDARDASGGLIAAVTDREILSAYRLLARDVGVFVELGSAASVAGLLQQAA
AGAVPRGSTVVCTVTGHGLKDPEWAISTAPAPVTIANDPLAAARSLDLA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggggtctaatcgacgcgtaccgagatcggttgccggtcaccgcgaccaccccg
gtcgtcaccctgcacgaggggaacaccccgctgttgccggcaccggtgctgtcggggcga
accgggtgcgaggtctatctgaaggtcgagggtgccaacccgaccggctccttcaaggac
cgggggatgaccgtggcggtctccaaagcggtcgaggcagacaacaaagtgatcatctgt
gcctcgaccggcaacaccagcgcctcggcggcggcctacgcggcgcgagctggcctgacc
tgtgcggtgctggtgccgcagggcaagatcgcgctgggcaagctcgcccaagcattggtg
catggtgcccgactgctccaggtcagcggtaacttcgacgactgcctgtcgttggccgcg
aaactcgcccaggactatccggtcgccctggtgaactcggtgaacattgatcgcctacac
ggccagaaaaccgccgcgttcgagatcgtcgaggcgcttggtgccgcgccggacatccac
tgcatgccggtcggcaatgcggggaacatctccgcctactggctcggctactcggaggaa
cgggcggccggaaacatcccccagaccccgaagctctacggtttccaggccgctggcgcc
gcgccgatcgtcaccggccaggcggtgcgtgaaccggccacgatcgccaccgcaatccgg
atcggcaatccggcgagctggacgagagcgctggatgcccgggacgcctctggcggtctg
atcgccgcggttaccgaccgggagatcctgtccgcgtaccggctgctcgctcgcgatgtc
ggggtcttcgtcgagttgggtagcgctgcgagtgtcgcgggactgctccagcaggccgcc
gcgggcgcggtgccgcggggttcgacggttgtctgcacggtcaccggtcacggcctgaaa
gacccggagtgggcgatctctaccgcccccgcgccggtgaccatcgccaatgaccccctg
gccgcggcccgttcgctcgacctggcctga

DBGET integrated database retrieval system