KEGG   Spirochaeta thermophila DSM 6578: Spith_0168Help
Entry
Spith_0168        CDS       T02016                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spith_0168
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spith_0168
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spith_0168
Enzymes [BR:stq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spith_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
214317..215540
Genome map
AA seq 407 aa AA seqDB search
MQKVYNDFFGTFGGRYVAEVLRRPLDELEQAFLEAMADPAFHVELAEARRHFVGRPTPLL
YAENATRALGGSRIYIKLEGLANTGAHKINNALGQALLAKRMGKRRIIAETGAGQHGVAT
ASVCARLGLECTVYMGEVDMARQRPNVYLMELFGAKVVPVCSGSRTLKDAVNEALRDWAA
SWEDTHYLLGSALGPSPFPDMVREFQSVVGRELVEQMREQVGEEVVALVACVGGGSNAIG
FFAPFIEADRPKLVGVEAGGRGNGPGEHAARMSGAGVEGVVHGYKSLFLLDEDGQVLPTH
SISAGLDYPGIGPQLAHLGRTGRISFTTASDEEALEALKFFARHEGLVFALESAHAGAVA
MKMAREGSPEKAIIVNMSGRGDKDIFITAKALDGEKWREFLLREASS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggtgtataacgactttttcgggaccttcggggggcggtacgtggccgaggtg
ctcaggcgcccgctcgacgaactggagcaggcctttctggaggccatggccgatcccgcc
ttccatgtagagctcgccgaggcccggcgccacttcgtgggacgtcccacccctctcctg
tacgcagagaatgccaccagggcgctgggaggaagcaggatctacataaagctcgagggt
ctcgccaacacaggggctcacaagatcaacaatgccctcggccaggccctccttgccaag
cggatgggcaagcggaggatcatcgccgagacaggggcagggcagcatggggtggcgacg
gcgagcgtgtgcgcacggcttggcctcgagtgcacggtctacatgggagaggtggacatg
gcgcgacagcggcccaatgtctacctgatggagctcttcggtgcgaaggtggtcccggtg
tgcagtggctctcgcaccctcaaggatgcggtgaacgaggccctgcgtgactgggccgcc
tcctgggaggatacccactacctgctcggttcggctctggggccgagccccttccccgac
atggtgcgggagttccagtcggtggtcgggagggaactcgtggagcagatgagggaacag
gtgggtgaggaggtggtggccctggtggcatgtgtggggggagggtcgaacgccatcgga
ttcttcgccccgttcatcgaggccgaccggccgaagctcgtgggtgtggaggccgggggg
agggggaacggtccaggagagcatgccgcccgtatgagtggggcaggggtggagggagtg
gtccacggctacaagagcctcttcctcctcgacgaggacgggcaggtgctccccacccac
tcgatctcggccggactcgactatccggggatagggcctcagctcgcccatctggggagg
accggcaggatctccttcaccacggcctcggacgaggaggcgctcgaggccttgaagttc
ttcgcccgccatgaaggtctggtctttgccctcgagagcgcccacgcaggagccgtggcc
atgaagatggcgcgggagggctccccggagaaggccatcatagtgaacatgtctggcagg
ggcgataaagacatcttcatcaccgccaaggccctcgatggtgagaagtggcgggaattc
ctgctgagagaggcttcctcatga

DBGET integrated database retrieval system