KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t2901Help
Entry
t2901             CDS       T00121                                 

Gene name
recD
Definition
(GenBank) exonuclease V alpha-subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:stt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    t2901 (recD)
Enzymes [BR:stt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     t2901 (recD)
DNA repair and recombination proteins [BR:stt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     t2901 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 UvrD-helicase DUF2075 AAA_22 AAA_28 AAA_16 UvrD_C MukB PhoH CbiA T2SSE AAA_29 Bcl-2 FtsK_SpoIIIE SRP54 DUF4277 TrwB_AAD_bind NTPase_1 AAA
Motif
Other DBs
NCBI-ProteinID: AAO70455
UniProt: Q8Z420
Position
complement(2985708..2987543)
Genome map
AA seq 611 aa AA seqDB search
MTIQKRLLEAVEQKLLRPIDAQFALTVAGNDDPAVTLAAALLSHDAGEGHVCLPLSRLTL
TEEAHPLLVAWISETATPIDWKKRLLASAAVSCGDSPAPLILCGDRLYLNRMWCNERTVA
RFFNEVNQAIAVDEDQLSRILDALFPPTDEVNWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGAALRQLPLTDAQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPPHGRVIFLGDRDQ
LASVEAGAVLGDICAYVNAGFTAERARQLSRLTGSAIPAGAGTQAASLRDSLCLLQKSYR
FGSDSGIGKLAAAINCGDRSAIQAVFQQGFSDIEKRTLQSSDDYAGMLDEALAGYGRYLR
LLHEKAAPEAILQAFNEYQLLCALREGPFGVRGLNDRIEQAMVQQRKIQRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGLRVWFVMPDGTIKSVQPSRLPEHDTTWAMTVHK
SQGSEFDHAALILPSQRSPVVTRELVYTAVTRARRRLSLYADERILAGAIVTRTERRSGL
ATLFDEVSRIG
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccagaagcggttgctggaggccgttgaacaaaaactcttacggcccattgat
gcccagtttgctttaaccgtcgccggtaacgacgatcccgccgtgacgctggcggcagcg
ctgcttagtcatgacgcaggtgaaggtcacgtgtgtctgccgttgtcgcgtttaacgtta
acggaggaggcgcatcccttactggtcgcctggataagcgaaacggctacgccaatcgac
tggaaaaagcggttactggcgtctgcggcggttagctgcggcgatagccccgcgccgtta
attctgtgcggcgatcgcctctacctgaatcgcatgtggtgcaacgagcgtacggttgcg
cgcttttttaacgaggttaaccaggccatcgccgtagatgaagatcagttatcccgtatt
ctggacgcgctattccctccgacagacgaggtgaactggcaaaaggtggccgccgccgta
gcgctaactcgccgtatctccgtgatttcaggcggtcccggcaccggtaaaaccaccacc
gtcgcgaagctgctggcggcattaattcaaatggcggatggcgaacgttgccgtatccgg
ctggcggcgccaaccgggaaagcggccgcacgcctgacggagtcgctcggcgcggcgttg
cgtcagcttcctcttaccgatgcgcagaaaaagcgtataccggaggacgccagtacgctg
caccgactgctgggcgcacagcccggcagccagcgattacgccatcatgcgggcaacccg
ctgcatctggacgtgctggtggtcgatgaggcatcaatgattgatttgccgatgatgtca
cgtttgattgacgctctgccgccgcacgggcgggtcatttttcttggcgatcgcgatcag
ttggcatccgttgaggcgggcgctgtgttgggcgatatttgcgcctatgtcaacgcaggg
tttacggcggaacgcgcccgacagctaagtcgactcactggtagcgccattccggcgggg
gccggaacgcaagccgcgtctttacgcgatagcctctgtttgttgcaaaagagctaccgt
ttcggcagcgattctggcatcggcaagctggcggcggcaattaactgtggcgacaggtcg
gcaatccaggctgtttttcagcaggggtttagcgatatagagaagcgtacattgcaaagc
agcgacgattatgccgggatgctggatgaagcgctggcgggctatgggcgctacctgcgg
ttgctgcatgaaaaagcggcgccggaggcaatccttcaggctttcaatgagtatcaactg
ctttgtgcgctgcgcgaaggcccatttggcgtgaggggactgaatgaccgcattgagcag
gcgatggtgcagcaacgaaaaattcagcggcatccgcactctcgctggtatgaagggcgt
ccggtaatgattgcgcgcaacgatagcgcgttggggctatttaacggcgatattggtatt
gcgctcgatcgcgggcaggggttacgcgtctggtttgtgatgccggacggcacgatcaag
tccgttcagcccagccgtctgccggaacatgatacaacctgggcgatgacggtacataaa
tcacaggggtctgaatttgatcacgccgcgctgattttacccagccaacgttcgccggtc
gtgacgcgggagctggtgtataccgctgttacgcgggcgcggcggcggttatcgctgtat
gccgatgaacggatcctggcaggcgcgattgtgacgcgaacggaacggcgcagcgggtta
gccaccttatttgatgaagtcagtcgtatcggataa

DBGET integrated database retrieval system