KEGG   Streptococcus thermophilus JIM 8232: STH8232_2092Help
Entry
STH8232_2092      CDS       T02026                                 

Definition
hypothetical protein
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:stu00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    STH8232_2092
Enzymes [BR:stu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     STH8232_2092
Amino acid related enzymes [BR:stu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   STH8232_2092
Transfer RNA biogenesis [BR:stu03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    STH8232_2092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1742787..1744241)
Genome map
AA seq 484 aa AA seqDB search
MAKDIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGTFIIRIEDTDRKRHVEDGERSQL
DNLRWLGIDWDESPETHENYRQSERLPLYQKYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYINEFLGMTEEEKAAYIAEREAAGIIPTVRLAVNESGIYKWHDIVKGDIEFEG
GNIGGDWVIQKRDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLITNSETGKKLSKRDTNTLQFIEDYRKKGYLPEAVFNFIALLGWNPGGEDEIFSR
EELIKLFDENRLSKSPAAFDQKKLDWMSNDYIKHADFDKVFALCKPFLEEAGRLTDKAEK
LVELYKPQMTAAEEIVPLTDLFFEDFPELTAAEKEVMAGETVPTVLEAFKAKLEAMSDDE
FVTENIFSQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPETIFLLGREKSIKHIDQV
LATL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaagatatccgcgttcgttacgcaccaagtccaacagggctgctacacattggt
aatgcccgtacggcattgtttaactacctctatgcacgtcatcatggcggtactttcatt
atccgtattgaagatactgaccgtaagcgtcacgttgaagatggtgagcgttcacagctt
gataatttgcgttggttgggaattgactgggatgaaagtcctgaaacacatgaaaattac
cgtcaatcagagcgtttgccactttaccaaaaatatattgatcaacttttggcagaaggt
aaggcttacaagtcatatgtaactgaagaagagttggctgcagaacgtgaacgtcaagaa
gcagcaggtgaaacacctcgttatattaacgagttccttggtatgactgaagaagaaaaa
gccgcctacatcgcagaacgtgaagccgctggcattattcctacagttcgtttggctgtt
aatgagtcaggaatctataaatggcatgatatcgttaaaggagatatcgaatttgaaggt
ggcaatatcggtggtgattgggttatccagaagagggatggttatccaacttacaacttt
gcggttgttgttgatgaccacgatatgcaaatttcacacgttatccgtggagatgaccac
attgccaatacgccaaaacagcttatggtttatgaggctcttggttgggaagcgcctgag
tttgggcacatgacccttatcaccaattctgaaactggtaagaagttgtctaaacgtgat
actaatacccttcaatttatcgaagattaccgtaaaaaaggttacctgccagaagcagtc
ttcaactttattgctcttctaggttggaaccctggtggtgaggacgaaatcttctctcgc
gaagaacttatcaaactctttgatgaaaaccgtctaagtaagtctccagcggcctttgac
cagaagaaactggattggatgagtaatgactacatcaagcatgctgatttcgataaggtc
tttgctctttgcaaacccttcttggaagaagctggtcgtttgacagataaagctgaaaaa
ttagttgaactctataaaccacagatgacagctgcggaagaaattgtacctcttacagac
ctctttttcgaagatttcccagaattgacagcggctgaaaaagaagttatggctggtgaa
acagtaccaacagtacttgaggcctttaaagctaaacttgaagctatgtcagatgatgag
tttgttacagaaaatattttctcacaaattaaggctgttcaaaaagaaacaggaattaaa
gggaaaaacctcttcatgccaattcgtatagctgtttcaggagagatgcacggcccagaa
ttaccagagactatctttttacttggtcgtgaaaaatctattaaacatattgatcaagtt
ctcgcaacactataa

DBGET integrated database retrieval system