KEGG   Sulfurimonas autotrophica: Saut_0712Help
Entry
Saut_0712         CDS       T01316                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sua  Sulfurimonas autotrophica
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sua00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
689312..689800
Genome map
AA seq 162 aa AA seqDB search
MYRKRKINERLDSFYSLRFPFHALAKSKHRYETVVGIGGNVGDVRRRFERLFVVLQKDKR
VSLVKTSLILKNPPFGYKNQDDFFNSILVLKTSMQPKVFLCYLLRLEKKFGRRRSFANAP
RTLDLDIIFFDNRKINTKDLIVPHPFYAQRESVVIPLAGVGI
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtatagaaaacgcaagataaatgaaagattagactctttttacagcttgcggtttcct
tttcatgctctcgctaaaagtaagcatagatatgaaacagtagtcggaatcggcggaaat
gtcggagatgtccgtcgccggtttgaacgcctttttgttgtattacaaaaagacaaaaga
gtatcattagtaaaaacatcattgattttaaaaaatcctccttttggttataaaaaccaa
gatgattttttcaactcaatattggttctaaaaacttcaatgcaaccaaaagttttttta
tgctatttactaagattagagaaaaaattcggtagacgtagaagttttgccaatgcacca
aggacattagatttggatattatattttttgataatcgcaaaataaatacgaaagattta
atcgtaccgcaccctttttatgcacaaagagaaagtgtggttattcctttagccggtgtt
ggcatatga

DBGET integrated database retrieval system