KEGG   Streptococcus suis JS14: SSUJS14_0918Help
Entry
SSUJS14_0918      CDS       T02024                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sui  Streptococcus suis JS14
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sui00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSUJS14_0918
   00670 One carbon pool by folate
    SSUJS14_0918
Enzymes [BR:sui01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SSUJS14_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
936906..937418
Genome map
AA seq 170 aa AA seqDB search
MTKKIVAIWAQDENGLIGKGDRLPWSLPADFAHFKKTTTGHTMVMGRITFDGMGKRALPN
RHTIVLTTDKTYQLESERITILHSVEDVLDWYNKQEQTLFVIGGGQIFTAFAPYIETLIV
TDIHGQFNGDVYFPKAFPMEKFQLQSANLRPKDEKNPYDFTIKTYERRDG
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaagattgttgccatttgggctcaagatgaaaatggattgattggaaaaggt
gatagacttccttggtcattgccagctgactttgctcatttcaaaaaaacgacaacaggt
cacacgatggtgatgggacgtataactttcgacggcatgggtaaacgtgctcttcccaat
cgtcacaccatcgttttgacaacggataaaacctatcaactagagagtgaacgtattacc
attttacacagtgtggaagatgttctagattggtataacaaacaggagcagacactattt
gtgattggtgggggacaaatttttactgcttttgcaccttacattgaaacattaatagtg
acagatattcacggtcaatttaatggcgatgtgtattttccgaaagcatttcctatggag
aaatttcagctacaaagcgccaatttacgtccaaaagacgagaaaaacccgtatgatttt
acaataaaaacctatgaaagaagagatggttag

DBGET integrated database retrieval system