KEGG   Staphylococcus aureus subsp. aureus JKD6159: SAA6159_02517Help
Entry
SAA6159_02517     CDS       T01870                                 

Gene name
gpxA2
Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:suj00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SAA6159_02517 (gpxA2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SAA6159_02517 (gpxA2)
Enzymes [BR:suj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SAA6159_02517 (gpxA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2704718..2705215)
Genome map
AA seq 165 aa AA seqDB search
MNNRNVYDIEVSDYKGLTYKLEVFRGKVILVVNTATECIYSEQLKKLETLFQKYKDRGFV
VLSFPNNNFDNRQPGSNEEILKISREKFGVTFPVLAKISVNGNDEHPLFTHLKNEQPGIF
GSPIKWNFTKFIIDRQGNVVNRFLPMEDPLDISTNIEILLQESSS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagaaatgtgtatgatatcgaagtaagtgattataaaggcttaacttataaa
ttagaagtatttagaggtaaagtgattttagttgttaatactgcaacggaatgtatatat
agcgaacaattgaaaaaactagagactttgtttcaaaaatataaggatcgtgggtttgta
gtgttgagttttccgaataataattttgacaatcgacaaccaggttctaatgaagaaatc
ttgaaaattagtcgtgagaaatttggtgttacatttccagtgctagctaaaatatctgtg
aacgggaacgatgaacatccgttatttacgcatttaaagaatgaacaaccaggaatcttt
gggtccccaataaaatggaatttcacaaaatttataatcgatcgacaaggcaatgttgta
aatcgattcttgccaatggaagatccattggatatatcgacaaatatagaaatattattg
caagaatcttcatcttaa

DBGET integrated database retrieval system