KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0052Help
Entry
SYO3AOP1_0052     CDS       T00715                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sul00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(61193..61978)
Genome map
AA seq 261 aa AA seqDB search
MENKKVAIYATRKADEIANKVFELGFEPFIEDVIKIQKLPEDIIVENIKMALDKKPEVFY
FTTGEGVNITFQKAKESNLYEKLKDFMESGKVFVRGYKARMVLLKEGFKDFINLESTDEF
IEKLKNADLTNLNFFVQMYGEKLPDLNAFLLSKGASMIEVSVYKYQIDTNKMDAFIEKLI
EGFYGAVLFTSAYQVDYLFKRAEEIFKKAKLVEALNQIVVITVGHITAKKLTKYGVYKVF
YPERERLTFALKILEKVFNDG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaaaaagtagctatatatgctacaagaaaggcagatgagatagctaataag
gttttcgaacttggttttgagccttttatagaagatgtaattaaaatccaaaaattacca
gaagatatcatcgttgaaaatataaaaatggctttagataaaaaaccagaagttttttat
tttacaacaggggagggggttaatataacctttcagaaagcaaaggaatccaatttatat
gaaaaactgaaagactttatggaatcaggaaaagtatttgttagaggttataaggcaaga
atggtgcttttgaaagaaggttttaaagattttattaatcttgaaagcactgatgagttc
atagaaaagcttaaaaatgctgacctgacaaacctaaatttcttcgttcaaatgtatggt
gaaaaattgcctgatttgaatgcttttttattaagtaaaggtgcctctatgattgaagtt
tcggtttataaataccaaatagatacaaataaaatggatgcttttattgaaaagctaata
gaaggtttttatggagctgttctctttacttctgcgtatcaagttgactatctatttaaa
agagcagaagaaatttttaaaaaagcaaaacttgttgaagctttgaatcaaattgtagta
attactgtgggacatataacagctaaaaaattaaccaaatacggtgtttataaagttttt
tatcctgagagagaaagattaacttttgcactaaaaattttagaaaaggtttttaatgat
gggtaa

DBGET integrated database retrieval system