KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_1048Help
Entry
SYO3AOP1_1048     CDS       T00715                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sul00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1086541..1087104)
Genome map
AA seq 187 aa AA seqDB search
MVIDKNKIEQAIRLFLEGIGEDPNREGLRDTPKRVAKMWEEFESYREMNMTIFEEVGSYD
EMVVVRDIQFYSLCEHHLLPFFGKAHVAYIPDKKVCGLSKIVRVVNKFSYRPQVQERLTA
EIAEYLEKELQPKGVAVVMEAVHLCMAMRGVRNPESITVTSKLTGRFLECQKTREEFLNL
INSHKKM
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggtaatagacaaaaataagattgaacaggcaataagattatttttagaaggtattgga
gaagacccaaacagagaaggtttaagagacacgccaaaaagagttgctaaaatgtgggaa
gagtttgaaagttatagagaaatgaacatgaccatctttgaagaagtaggaagctacgat
gagatggtagttgtaagagatattcaattttattctttatgcgaacatcatttacttcct
ttttttggaaaagcgcacgtagcatacattccggataaaaaagtatgcggattgtctaaa
attgttagagttgtaaacaaattttcctacagaccgcaagttcaagaaagattgacggcg
gaaattgctgaatatcttgaaaaagaattacagccaaaaggtgtagccgttgtaatggag
gcagttcacctttgtatggcaatgagaggagtaagaaatccagaatctatcacagtaaca
agcaagcttacaggaagattcttagagtgtcaaaaaacaagagaggaatttttgaatttg
ataaattctcacaaaaagatgtga

DBGET integrated database retrieval system