KEGG   Uncultured Sulfuricurvum sp. RIFRC-1: B649_01500Help
Entry
B649_01500        CDS       T02537                                 

Definition
uroporphyrinogen III synthase hem4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sulr  Uncultured Sulfuricurvum sp. RIFRC-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sulr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
297050..297700
Genome map
AA seq 216 aa AA seqDB search
MRPIYLISKTPYEGVIHIPILTISFLQPRIDFDTYQGIILTSKQALLALEHYTFGWEKLQ
CICVSEGTAEAARKAGALNVEAADGYGRSIPAILRTKAGKGKWLYVRPKVIASDWVMEAR
KEGVEIDEAVVYETTCNEAAREYTLDKDAVLVFTSPSSIDCFCASYPILSSYSIVAIGKT
TRAAFKTAKEVHVSPLTSVESAIELARKIAQDASAF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcccgatttatctcatctcaaaaactccctatgagggagtaattcatatccctatc
ctcacgatctcttttttacaacctcgtattgattttgacacctatcaggggattattctc
acttcgaaacaagcattgttagctttagaacattacacgtttggatgggaaaaactgcaa
tgcatctgcgtatcggaaggtacggcagaagcggcacgaaaagcgggtgctctgaatgtt
gaagcggcagatggctatgggagatcgattccggctattttacgaaccaaagcgggaaag
ggaaaatggctttatgtgcgtccgaaagtgattgcttcggattgggttatggaagctcga
aaggagggggttgagattgacgaagcagtggtatatgagacgacctgcaatgaagcggcg
agagagtatacgctagacaaagatgccgttttagtctttacttctccctcatccatcgat
tgtttttgcgcttcttatccgatcctttcgtcgtacagtattgtcgctatcggtaaaaca
actcgcgctgctttcaaaactgccaaagaggttcatgtaagtcctttaaccagtgtcgaa
tcggcgattgaactggcacgaaaaattgcccaagacgcatctgcgttttaa

DBGET integrated database retrieval system