KEGG   Streptococcus suis SS12: SSU12_0213Help
Entry
SSU12_0213        CDS       T02025                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
suo  Streptococcus suis SS12
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:suo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSU12_0213
Enzymes [BR:suo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SSU12_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(211650..214139)
Genome map
AA seq 829 aa AA seqDB search
MNEVYFTGTIDRIIFENPSNFYKILLLEIEETDADYDDYEIIVTGTIADVIEGEDYRFYG
NLVTHPKYGQQLQISRYERSKPTSAGLVKYFSSEHFKGIGRKTAEKIVELYGEDTIDKIL
AEPEKLTQITGLSSKNMQAFVEKLRLNYGTELILAKLAEYGIPNKLAFQIQDQYKEKTLQ
IIEENPYQLVEDVQGLGFTIADRIAENLGIASDSPQRFRAGMLFSLIHRSMETGDTYVEA
RDLLEATLELLEKSRHTELDPAAVAKELTGLIADDKVQQEGTKIFDNSLYFAEHGIHTNL
TRLMGKNGFKPFPRADVEAAIAELESISSLTYDNIQKEAIVQAITNPLFILTGGPGTGKT
TVINGIIAVYAILHKIDLTRNREECPVLLAAPTGRATRRMNELTGLPSATIHRHLGLVEG
QEESYRDDYLDADFIIVDEFSMVDTWLANQLFQNISSQTQVLIVGDAEQLPSVSPGQVLA
DLLKIDKLPSITLERIYRQSDDSTIVTLASQIRQGALPSDFREKKADRSYFEAQNEQIPA
LIERIVGAAIKSGIPANEVQILAPMYRGAAGIDQLNTMTQALLNPLEEGELEFLHNEQAF
RQGDRVIHLVNDAEANVFNGDLGYITDLLPAKYTDSKQDEITINFDGSEVTYPRNEWYKI
TLAYAMSIHKSQGSEFQVVILPITRTSHRMLQRNLVYTAITRSKSKLILLGEISAFDYAV
KNAGTVRKTYLVPRFQGEMAEQESKESLIKKDESKTATTTQTQPPTQPDRKEQVKVVKEN
NQQLSLLDQDQPEKTSPQPTEYILTVDNLLTIDPMIGIEQADIEEFFKA
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtgtattttaccggtactattgaccggattatttttgaaaatcctagtaat
ttttataaaatccttctccttgaaatcgaggagacagacgcagactatgatgactacgaa
attattgtgaccggaacgattgccgatgtcattgaaggagaagactatcgtttctatggc
aatctggtcacccatcccaagtatggtcagcagctgcaaatttcgcgttacgaacgcagc
aagcctacctcagctggtctggtcaagtatttctccagcgagcatttcaagggaattgga
cgcaaaacagctgaaaaaatcgttgagctctatggcgaagataccattgataagatttta
gctgaacctgaaaaactaacccaaatcacaggcctatccagcaagaacatgcaggcattt
gtcgaaaaactccgcctcaattatggaaccgagttgatcttggcaaaactagccgagtat
ggcattcccaataaattggcctttcaaatccaagaccagtataaggaaaaaacacttcag
attattgaagaaaatccctatcaactggtcgaagatgtccaggggctcggctttaccatt
gccgataggattgcggaaaatctaggaattgccagtgattcaccccaacgttttcgggct
ggcatgctctttagtctcattcatcgctccatggaaacaggcgatacctatgtggaggcc
agagacttgctggaagcaacccttgaactgctggaaaaatcccgccatacagagctggac
cccgctgctgttgccaaagaattgacgggactgattgcagacgacaaggtacagcaagaa
ggcacaaagatttttgacaacagcctctactttgccgaacatggtatccatacaaaccta
actcgcctgatgggaaaaaacggcttcaagcccttcccacgcgcagacgtcgaggctgcc
atagcagagctggaaagcatatcttctctcacctacgataacattcaaaaagaagccatt
gtccaagccattaccaatccgcttttcattctgacaggcgggccagggactggaaaaaca
acggttatcaacggcattatcgcagtctatgctatcttgcataagattgacctgacgcga
aaccgagaagaatgcccagtcctcctagccgctccaactggacgagcaaccagacggatg
aatgaattgacagggctgccttccgccaccatccaccgccatctcggtctggtagaagga
caggaggaatcctaccgtgatgattatttggatgccgactttatcatcgtggatgagttt
tctatggtagatacttggttggcaaaccagctcttccagaatatctcctcccagacccaa
gttctgattgtcggcgatgccgagcaattgccttctgtcagccccggtcaagtacttgct
gacctcttgaaaattgacaagctgcccagcattactctagaacgtatctatcgtcaatcc
gatgattcgaccattgttaccctagccagccagattcgacagggtgctctgcctagcgat
tttcgtgagaaaaaggctgaccgttcctattttgaagcccagaatgaacaaattccagcc
ctgattgagcgcattgtcggcgcagccatcaagtcaggtattcctgcaaacgaggtacag
atcctcgctcccatgtaccgtggggccgcaggcatcgaccaactcaacactatgacccag
gccctgctcaatccactggaagagggagagttagaattcctgcataacgagcaagccttc
cgccaaggcgaccgggtcattcatttagtcaacgatgccgaggccaatgtcttcaatggt
gatttaggctacatcaccgacctccttcctgccaagtacaccgactccaagcaggacgaa
attaccatcaacttcgacggtagcgaggtcacctatccccgaaacgaatggtacaagatt
accctggcctatgccatgtccatccacaagtcccaaggcagcgagtttcaggtagtcatc
ctccccatcacccgcaccagccaccgtatgctccagcgcaatctggtctacaccgccatc
acccgctccaagagcaagctcatcctcctgggcgaaatctccgccttcgactacgccgtc
aaaaacgccggcaccgtccgaaaaacctatctggtcccacgtttccaaggggaaatggca
gagcaggaaagcaaggaaagcctgattaaaaaagacgaaagcaaaacagctacaaccacg
caaacccagccccctactcagccagacagaaaagaacaggttaaagtagtcaaagaaaac
aaccaacaactctcccttcttgatcaagaccagccagaaaaaacaagtccccaacccaca
gaatacattttgactgtagacaacctactaaccatcgaccccatgattggcatagaacag
gcagatattgaagaattttttaaagcataa

DBGET integrated database retrieval system