KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_0750Help
Entry
MS7_0750          CDS       T01950                                 

Gene name
pfkB
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:suz00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
788001..788921
Genome map
AA seq 306 aa AA seqDB search
MIYTVTFNPSIDYVIFTNDFKIDGLNRATATYKFAGGKGINVSRVLKTLDVESTALGFAG
GFPGEFIIDTLNNSAIQSNFIEVDEDTRINVKLKTGQETEINAPGPHITSTQFEQLLQQI
KNTTSKDIVIVAGSVPSSIPSDAYAQIAQITAQTGAKLVVDAEKELAESVLPYHPLFIKP
NKDELEVMFNTTVNSDADVIKYGRLLVDKGAQSVIVSLGGDGAIYIDKEISIKAVNPQGK
VVNTVGSGDSTVAGMVAGIASGLTIEKAFQQAVACGTATAFDEDLATRDAIEKIKSQVTI
SVLDGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacagtgactttcaatccttcaattgactatgtcatttttacgaatgatttt
aaaattgatggtttgaacagagcaacagcaacatataaattcgctggggggaaaggtatt
aatgtctcgcgcgtcttaaagacattggatgttgagtcaactgccttgggatttgcaggt
ggatttcctggagaattcattatagatacattaaataacagtgcaattcaatcgaatttt
attgaagttgatgaagatacacgtattaatgtgaaattaaaaacaggacaagaaacagaa
atcaatgcaccgggtcctcatataacgtcaacacaatttgaacaactgttacaacaaatt
aaaaatacaacaagcaaagatatagttattgttgctggaagtgtaccaagtagtattcca
agcgatgcgtatgcgcaaattgcacaaattacagcacagacaggtgctaaattagtagtc
gacgctgaaaaagaattggctgaaagcgttttaccatatcacccactatttattaaacct
aataaagatgaattagaagtgatgtttaatacaacagtgaactcagacgcagatgttatt
aaatatggtcgtttgttagttgataaaggtgcgcaatctgttattgtctcgcttggcggt
gatggtgctatttatattgataaagaaatcagtattaaagcagttaatccacaagggaaa
gtggttaatacagttggctctggtgatagtacagttgcaggcatggtggctggaattgct
tcaggtttaacgattgaaaaagcattccaacaagcagtcgcatgcggtactgccacggca
tttgatgaggacttagcaacacgggacgctatagaaaaaataaaatcacaagttacgatt
agcgtacttgatggggagtga

DBGET integrated database retrieval system