KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_1705Help
Entry
MS7_1705          CDS       T01950                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
suz00010  Glycolysis / Gluconeogenesis
suz00030  Pentose phosphate pathway
suz00051  Fructose and mannose metabolism
suz00052  Galactose metabolism
suz00680  Methane metabolism
suz01100  Metabolic pathways
suz01110  Biosynthesis of secondary metabolites
suz01120  Microbial metabolism in diverse environments
suz01130  Biosynthesis of antibiotics
suz01200  Carbon metabolism
suz01230  Biosynthesis of amino acids
suz03018  RNA degradation
Module
suz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suz_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:suz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS7_1705 (pfkA)
   00030 Pentose phosphate pathway
    MS7_1705 (pfkA)
   00051 Fructose and mannose metabolism
    MS7_1705 (pfkA)
   00052 Galactose metabolism
    MS7_1705 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MS7_1705 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MS7_1705 (pfkA)
Enzymes [BR:suz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MS7_1705 (pfkA)
Protein phosphatases and associated proteins [BR:suz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MS7_1705 (pfkA)
Messenger RNA biogenesis [BR:suz03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MS7_1705 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEW65712
Position
complement(1804464..1805432)
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDT
IQRGGTFLYSARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQ
TIGIPGTIDNDINGTDFTIGFDTALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLAL
WAGLSVGAETIVVPEVKTDIKEIADKIEQGIKRGKKHSIVLVAEGCMTAQDCQKELSQYI
NVDNRVSVLGHVQRGGSPTGADRVLASRLGGYAVDLLMQGETAKGVGIKNNKIVATSFDE
IFDGKDHKFDYSLYELANKLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgcagttttaactagtggtggagattcacctggaatgaatgctgccgta
agagcagttgttcgtacagcaatttacaatgaaattgaagtttatggtgtgtatcatggt
taccaaggattgttaaatgatgatattcataaacttgaattagggtcagttggggatacg
attcagcgtggaggtacattcttgtattcagcaagatgtccagagtttaaggagcaagaa
gtacgtaaagttgcaatcgaaaacttacgtaaaagagggattgagggccttgtagttatt
ggtggtgacggtagttatcgcggtgcacaacgcatcagtgaggaatgcaaagaaattcaa
actatcggtattcctggtacgattgacaatgatatcaatggtactgattttacaattgga
tttgacacagcattaaatacgattattggcttagtcgacaaaattagagacactgcgtca
agtcacgcacgaacatttatcattgaagcaatgggccgtgattgtggagatctagcatta
tgggctggattatcagttggtgctgagacaattgtagttccagaagtgaaaacagatatt
aaagaaatagctgataaaattgaacaaggtattaaacgtggtaagaaacactcaatcgtt
cttgtagcagaaggttgtatgactgcgcaagattgtcaaaaagaattatcacaatacatc
aatgttgataatagagtgtctgtgttaggtcacgttcaacgtggtggtagcccaacaggt
gcggatagagttttagcatcacgtttaggtggatatgcggtagacttattaatgcaaggt
gaaacagctaagggtgttggaattaagaacaataaaattgtagcaacatcttttgatgaa
atttttgatggtaaagatcataaatttgattatagtctatatgaacttgctaacaagtta
tctatataa

DBGET integrated database retrieval system