KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_1705Help
Entry
MS7_1705          CDS       T01950                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:suz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MS7_1705 (pfkA)
   01230 Biosynthesis of amino acids
    MS7_1705 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS7_1705 (pfkA)
   00030 Pentose phosphate pathway
    MS7_1705 (pfkA)
   00051 Fructose and mannose metabolism
    MS7_1705 (pfkA)
   00052 Galactose metabolism
    MS7_1705 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MS7_1705 (pfkA)
Enzymes [BR:suz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MS7_1705 (pfkA)
Protein phosphatases and associated proteins [BR:suz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MS7_1705 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1804464..1805432)
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDT
IQRGGTFLYSARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQ
TIGIPGTIDNDINGTDFTIGFDTALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLAL
WAGLSVGAETIVVPEVKTDIKEIADKIEQGIKRGKKHSIVLVAEGCMTAQDCQKELSQYI
NVDNRVSVLGHVQRGGSPTGADRVLASRLGGYAVDLLMQGETAKGVGIKNNKIVATSFDE
IFDGKDHKFDYSLYELANKLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgcagttttaactagtggtggagattcacctggaatgaatgctgccgta
agagcagttgttcgtacagcaatttacaatgaaattgaagtttatggtgtgtatcatggt
taccaaggattgttaaatgatgatattcataaacttgaattagggtcagttggggatacg
attcagcgtggaggtacattcttgtattcagcaagatgtccagagtttaaggagcaagaa
gtacgtaaagttgcaatcgaaaacttacgtaaaagagggattgagggccttgtagttatt
ggtggtgacggtagttatcgcggtgcacaacgcatcagtgaggaatgcaaagaaattcaa
actatcggtattcctggtacgattgacaatgatatcaatggtactgattttacaattgga
tttgacacagcattaaatacgattattggcttagtcgacaaaattagagacactgcgtca
agtcacgcacgaacatttatcattgaagcaatgggccgtgattgtggagatctagcatta
tgggctggattatcagttggtgctgagacaattgtagttccagaagtgaaaacagatatt
aaagaaatagctgataaaattgaacaaggtattaaacgtggtaagaaacactcaatcgtt
cttgtagcagaaggttgtatgactgcgcaagattgtcaaaaagaattatcacaatacatc
aatgttgataatagagtgtctgtgttaggtcacgttcaacgtggtggtagcccaacaggt
gcggatagagttttagcatcacgtttaggtggatatgcggtagacttattaatgcaaggt
gaaacagctaagggtgttggaattaagaacaataaaattgtagcaacatcttttgatgaa
atttttgatggtaaagatcataaatttgattatagtctatatgaacttgctaacaagtta
tctatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system