KEGG   Streptomyces venezuelae: SVEN_0864Help
Entry
SVEN_0864         CDS       T02274                                 

Definition
putative secreted alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sve  Streptomyces venezuelae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sve00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sve00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sve02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
988645..990237
Genome map
AA seq 530 aa AA seqDB search
MSRSVPGSSPSPARRSVLRGSLAASAALTLGGTGLAAPAFALSGRPRAEWGVQTGDVTAS
SGLLWVRSDRPARMVVETSATESFRRVRRHHGPLIGAGTDFTGTTPLRGLPAGEQIHYRV
TLADPDDPRRTGEPVVGTFRTAPERRRDGVRFLWSGDIAGQGWGINPDIGGFRAYEEMRR
LDPDFFLCSGDSIYADGPLQPSVTLPDGRIWRNVTTPEKSKVAETLDEYRGNFRYNLLDH
NVRAFNAQVPTVVQWDDHEVRNNWYPGQILDDARYTEKDVDVLASRALRAFGEYTPVSTL
HARGGGRGGRMHRVVRYGPLLDVFVLDMRSFRNANSPGRQADDTTGILGAGQLAWLKREL
AASTAVWKVLAADMPLGLVVPDGAANFEAVAQGDPGAPLGRELQIAELLRFVKHRRITGT
LWLTADVHYTSAQHYAPERAAFQDFAPFWEFVSGPLAAGGFPANALDATFGPERVFVRAP
ERANLSPMESPQYFGEVDIDGHSGELTVRLRAEGGTVLFSKVLKPGRVGQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggtccgtacccggcagttccccctcccccgcccggcgcagcgtgctgcgcggc
tcgctggccgcttcggcggcgctcaccctcgggggcaccggtctcgcggccccggcgttc
gcgctgtcgggccggccccgcgccgagtggggtgtgcagacgggtgacgtcacggcgtcc
tccggtctgctgtgggtgcgctcggaccggccggcgcgcatggtcgtcgagacttcggcg
accgagtcgttccggcgggtacgccggcaccacgggccgctgatcggcgcgggcacggac
ttcaccggcacgacgccgctgcggggtctgcccgcgggcgagcagatccactaccgggtc
accctcgccgacccggacgatccgcgccgcacgggcgagccggtcgtcggcaccttccgt
acggcccccgagcgtcgccgcgacggggtccgtttcctctggtcgggggacatcgcgggg
cagggctggggcatcaacccggacatcggcggcttccgcgcgtacgaggagatgcgccgg
ctggacccggacttcttcctgtgcagcggcgactcgatctacgccgacgggccgctccag
ccgagcgtgacgctgcccgacgggcggatctggcggaacgtcacgacgccggagaagtcc
aaggtcgcggagacgctcgacgagtaccgcggcaacttccgttacaacctcctcgaccac
aacgtccgggcgttcaacgcgcaggtgcccacggtggtgcaatgggacgaccacgaggtg
cgcaacaactggtacccgggccagatcctggacgacgcccgctacacggagaaggacgtg
gacgtgctggcctcgcgcgcgctgcgcgccttcggcgagtacacgccggtgtcgaccctc
cacgcgcgcgggggcgggcgcgggggccggatgcaccgggtggtgcggtacgggccgctg
ctcgacgtgttcgtgctggacatgcgctcgttccggaacgccaactcccccggccgacag
gccgacgacaccaccggcatcctgggcgccgggcaactggcctggctcaagcgggagctg
gccgcctccaccgccgtgtggaaggtgctcgcggcggacatgccgctcggtctcgtggta
ccggacggcgccgcgaacttcgaggccgtcgcgcagggcgatccgggcgccccgctgggg
cgcgagctccagatcgcggagctgctgcggttcgtcaagcaccggcggatcaccggcacg
ctgtggctgacggccgacgtccactacacctcggcgcagcactacgcgccggagcgggcg
gccttccaggacttcgcgcccttctgggagttcgtatcggggccgctggcagccggcggc
ttcccggcgaacgccctcgacgcgacgttcggcccggagcgggtgttcgtgcgggcgccg
gagcgggcgaacctgtcgccgatggagagcccgcagtacttcggggaggtcgacatcgac
ggccacagcggggaactgacggtgcgactgcgcgccgagggcggcacggtgttgttcagc
aaggtgctgaagccgggtcgcgtcgggcagtaa

DBGET integrated database retrieval system