KEGG   Shewanella woodyi ATCC 51908: Swoo_3578Help
Entry
Swoo_3578         CDS       T00676                                 

Definition
carbamoyl phosphate synthase small subunit
Orthology
K01956  
carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
swd  Shewanella woodyi ATCC 51908
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:swd00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:swd00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4370003..4371148)
Genome map
AA seq 381 aa AA seqDB search
MTKSALLVLEDGTVFSGIAIGADGHAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHI
GNTGTNDEDTESDSVHACGLIIRDLPLIASNFRNQQSLSDYLKANNIVGIADIDTRKLTR
ILREKGAQAGCILVGEQDVEKALAEAKAFPGLKGMDLAKEVTTDTQYQWRNGSWRLVGGL
PDDSPESDLKYKVVAYDYGVKRNILRMLVDRGCDVTVVPAQTPASEVLAMNPDGIFLSNG
PGDPEPCDYAIAAIQEILKTDIPVFGICLGHQLLALASGAKTLKMKFGHHGANHPVSNIE
QGNVMITSQNHGFAADETSLPANIKVTHKSLFDGSLQGIHLTDKPAFSFQGHPEASPGPN
DAAPLFNHFIELIELYRQNAK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgacaaagtctgccttactcgtactcgaagatggaactgtattctctggcatagctatt
ggtgccgatggacatgctgttggtgaagttgtttttaacacttcaatgacaggttaccaa
gagatccttactgatccctcatattctcgccaaattgtaactttaacctaccctcatatt
ggtaatactggaaccaatgacgaagacacagaatctgattcagttcatgcctgtggtcta
atcattcgagatcttcctttaattgccagtaacttccgtaatcaacaatccctcagtgac
taccttaaagccaataacattgttggtatagctgatattgatacgcgtaagttaacccgt
attctacgagaaaaaggcgcacaagctgggtgtatcctagttggtgagcaagacgtagag
aaagcgcttgcagaagcaaaagctttccctggtctaaaaggcatggatttagctaaagag
gtcacgactgacactcagtaccagtggcgcaacggaagctggcgtttagtcggtggttta
cctgatgactcaccagagtctgatcttaaatataaagttgttgcttatgactatggtgta
aaacgtaacatcctgcgtatgctagttgaccgtggttgtgatgtgactgtcgttccagct
caaacaccagcatctgaagtactcgcgatgaatcctgatgggatcttcctgtcaaatggt
cctggtgacccagagccatgtgattacgctattgcagcaattcaagagattctgaaaaca
gatatcccagtatttgggatctgtctaggccaccagttactggctttggcttcaggtgct
aagactttgaagatgaagtttggtcatcacggtgcaaaccaccctgtgagcaatatagag
caaggtaatgtgatgatcaccagtcaaaaccatggttttgctgctgatgagactagtttg
cccgctaacatcaaggtgacacataagtcactgtttgatggctctctgcaaggtattcat
ttaacagataagcctgcatttagcttccagggtcaccctgaagcaagtccaggtccaaat
gatgccgcacctttgttcaatcactttattgaacttatcgaattgtatcgtcagaacgcc
aagtag

DBGET integrated database retrieval system