KEGG   Sphingomonas wittichii: Swit_1625Help
Entry
Swit_1625         CDS       T00538                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
swi  Sphingomonas wittichii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swit_1625
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swit_1625
   00052 Galactose metabolism
    Swit_1625
   00500 Starch and sucrose metabolism
    Swit_1625
   00520 Amino sugar and nucleotide sugar metabolism
    Swit_1625
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Swit_1625
   00524 Butirosin and neomycin biosynthesis
    Swit_1625
Enzymes [BR:swi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Swit_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1808534..1809502
Genome map
AA seq 322 aa AA seqDB search
MTIVAVDLGGTNARFAVAELHDERRPTLGAVHVYKTADFSGLPAAWAAFARDLGHAPPSV
ASIAVAGPVEGELIRFTNNDWTIRPATVARELGIERVALYNDFAAMAAAVGVLDGDELVS
LGGPEGPLPDEGVTTVLGPGTGLGVAQLLRRRGRRIVLPTEGGHVDFAALDGFEETLLAR
LRARHRRVSVERIVSGPALAAIHETLAMIDGRAIVPRDDAALWQAATGGDDPLAAQALDR
LTMALGAVAGDLALAHGANAVVITGGLANRIEARLKSPLFHDRFRAKGRFETRMAQLPVR
LARHAQAGLLGAAAAYQEDGRR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgtcgcggtcgacctgggcggaaccaatgcgcgcttcgcggtggcggagctg
cacgacgagcggcgtccgacgctgggtgcggtccacgtctacaagaccgccgacttctcg
gggctccccgccgcctgggccgccttcgcgcgcgacctcggccatgcgccgccgtcggtc
gcgagcatcgccgtggcggggccggtcgagggcgagctgatccgcttcaccaacaatgac
tggacgatccgcccggcgacggtcgcgcgcgagctcggcatcgagcgggtcgccttgtac
aacgacttcgccgcgatggcggcggcggtgggcgtgctcgacggggacgagctggtctcc
ctcggcgggccggaagggccgctgccggatgagggcgtcaccaccgtgctcgggcccggc
accgggctcggcgtcgcccagctgctgcgtcggcgcgggcgccgcatcgtgctgccgacc
gagggcgggcatgtcgacttcgcggcgctcgacggcttcgaggagacgctgctcgcccgg
ctgcgcgcgcgccatcgccgggtgtcggtcgagcggatcgtctcgggaccggcgctcgcc
gccatccacgaaacgctggcgatgatcgacggccgggcgatcgtgccgcgggacgacgcc
gcgctgtggcaggcggcgaccgggggcgacgatccgctggcggcgcaggcgctcgaccgc
ctgaccatggcattgggcgcggtcgcgggcgatctcgcgctcgcgcacggcgccaacgcc
gtggtgatcaccggcgggctcgccaaccggatcgaggcccggctcaaaagcccgctgttc
cacgaccgcttccgtgccaagggccgtttcgagacgcgcatggcgcagctcccggtccgc
ctcgcccgccacgcgcaggcggggctgctcggcgcggcggcggcctatcaggaggatgga
cgaagatga

DBGET integrated database retrieval system