KEGG   Sphingomonas wittichii: Swit_2411Help
Entry
Swit_2411         CDS       T00538                                 

Definition
class I cytochrome c
Orthology
K08738  
cytochrome c
Organism
swi  Sphingomonas wittichii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:swi00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:swi02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2680240..2680605
Genome map
AA seq 121 aa AA seqDB search
MLKRLALASIVAASLGAPALAAPLPKPPVFGVCGTCHKVDKGAPNGIGPNLFGIANTKAG
EVPNFAFSPAMKKSTIKWTRANLVAFIQEPQKTVPGNRMPFGGLKNPDSAAQVADYILSL
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagcgccttgcacttgcctcgattgtcgccgcttccctgggggcgcccgcgctg
gccgcgccgctgcccaagccgccggtcttcggcgtgtgcggcacctgccacaaggtggac
aagggcgcgcccaacggaatcggccccaacctgttcggcatcgccaacaccaaggccggc
gaagtgcccaacttcgccttctcgcccgcgatgaagaagtcgacgatcaagtggacccgc
gccaacctggtcgccttcatccaggagccgcagaagacggtccccggcaaccgcatgccg
ttcggcggcctcaagaatccggattcggcggcgcaggtcgccgactatatcctgtcgctg
aaataa

DBGET integrated database retrieval system