KEGG   Sphingomonas wittichii: Swit_3255Help
Entry
Swit_3255         CDS       T00538                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
swi  Sphingomonas wittichii
Pathway
swi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:swi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Swit_3255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABQ69601
JGI: Swit3255
UniProt: A5VBD5
Position
complement(3583703..3584077)
Genome map
AA seq 124 aa AA seqDB search
MRSIAVMGMLLIGLAALPAPAVAAGDAAKGATLFKRCVACHTVDPGKKAGMGPNLAGVVG
RKAGATSFPYSPAMKAAAISWTPDKLDTFLTRPAAMIKGSRMAFAGLPNAQDRADVIAYL
ATRK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccatcgccgtcatggggatgttgctgatcgggctggccgcgctgccggccccc
gccgtcgcggcgggcgacgccgcgaagggcgcgaccctgttcaagcgctgcgtcgcctgc
cacacggtcgatcccggcaagaaggccggcatggggcccaacctggccggggtcgtcggg
cgcaaggcgggggcgaccagcttcccctactcgcccgcgatgaaggccgccgcgatcagc
tggacgcccgacaagctcgacaccttcctgacccgccccgccgccatgatcaagggatcg
cgcatggccttcgcgggcctgccgaacgcgcaggaccgggcggacgtgatcgcttacctt
gccacccggaaatag

DBGET integrated database retrieval system