KEGG   Synechococcus sp. CC9605: Syncc9605_2440Help
Entry
Syncc9605_2440    CDS       T00292                                 

Definition
glutathione synthetase (EC:6.3.2.3)
Orthology
K01920  
glutathione synthase [EC:6.3.2.3]
Organism
syd  Synechococcus sp. CC9605
Pathway
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Syncc9605_2440
Enzymes [BR:syd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     Syncc9605_2440
Exosome [BR:syd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Syncc9605_2440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2247172..2248095)
Genome map
AA seq 307 aa AA seqDB search
MRQLFVLDPLGQINPAKDSSAALMQAAHRAGDEVWACTPSDLIARGDEPLAIALPVTPEP
WITVGVAERQALAGFDVIWMRKDPPVDEAYLYATHLLEVAERAGVRVLNRPSALRSWNEK
LGALRFSRWMAPTLVAGRVSELLLFAQEQQEIVLKPLGGRAGLGVIRVNGQSPGLKALLE
LVTEQERLPVMAQAFLPSVSEGDKRILLVDGDPLGAINRRPSAGEFRSNLAVGGQAEATE
LTERERQICAALAPALRAEGLFFVGIDVIGGMLSEINVTSPTGVREVERLMNQPLADQTI
ERLRALV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagctgttcgttctggatccgctggggcagatcaatccagccaaggattcctcc
gctgcactaatgcaggccgcccatcgcgctggcgatgaggtgtgggcctgcacgccctcc
gatctgattgcgcggggcgatgaaccccttgcgattgccttgccggtgaccccggagcca
tggatcacggttggggtggcggagcgtcaggccctggctggatttgacgtgatctggatg
cggaaggacccgcctgtggatgaggcgtatctctacgccacccatctgttggaggttgcc
gagcgcgctggagtccgggtgctcaatcgccccagtgcgctgcgcagctggaacgaaaag
ctgggggccttgcgcttcagccgttggatggctcccacgcttgtggcagggcgggtgtct
gagctgctgttgtttgcccaggagcagcaggagatcgtgctcaaacccctggggggtcgt
gcaggcctgggggtgattcgggttaacggacagtcgccgggcttgaaggccctgctggaa
ctggtgaccgagcaggaacgcctgccggtgatggcccaggcctttctgccgtccgtgagc
gaaggtgacaagcgcatcctgctggtggatggtgaccccctcggggcgatcaaccggcgt
ccttcagccggagaattccgcagcaatctggcggtgggtggccaggcggaagccacagaa
ctcaccgagcgggaacgtcagatctgcgctgcccttgccccggcgctgcgggcggagggg
ctgttcttcgtcggcatcgacgtgatcgggggcatgctcagcgaaatcaacgtcaccagc
cccacgggggtgcgcgaagtggagcggttgatgaaccagccgctggcggatcagacgatc
gagcggttgcgcgcgctggtctga

DBGET integrated database retrieval system