KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1191Help
Entry
Synpcc7942_1191   CDS       T00300                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00230  Purine metabolism
syf01100  Metabolic pathways
Module
syf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Synpcc7942_1191
Enzymes [BR:syf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Synpcc7942_1191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 RsgA_GTPase ABC_tran AAA_22 MMR_HSR1 AAA_29 AAA AAA_18 AAA_17 AAA_14 CPT AAA_30 cobW NACHT AAA_28 NTPase_1 ATPase_2 TsaE AAA_21 NB-ARC RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ABB57221
JGI: Syn_pcc79421191
CyanoBase: Synpcc7942_1191
CYORF: Synpcc7942_1191
UniProt: Q8KPQ7
Position
1220349..1220900
Genome map
AA seq 183 aa AA seqDB search
MSIGRVVVLTGPSGVGKGTLLKAILSQHPEAFLSISATTRSPRPGEVDGQHYYFLSREEF
QTKIAEQEFLEWAEFAGNLYGTPRSPVIEQVNLGRTVILEIELEGARQVRKTLPSARQVM
LLPPSVEELERRIRERATEDEAAIARRLLQAQTEIGAAKEFDRCVINDQLDTAITALEAA
IFS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagtattggtcgtgtggtggtgttaacgggacctagtggtgtgggcaaaggcacgctc
ttgaaagcgatcttgtctcagcatcccgaggcctttctttccatctccgccaccacgcga
tcgccccgtccgggcgaagtcgacggtcagcattactacttcctcagtcgcgaggaattt
cagaccaaaattgctgaacaagaatttttagagtgggctgaatttgctggcaacctctac
ggcacaccgcgatcgccggtgattgagcaggtcaacctggggcgcaccgtcatcctcgaa
attgagctagaaggggctcgccaagtcaggaaaacgctcccctcagctcggcaggtgatg
ttgctgccacccagtgttgaggagctggagcgacggattcgggagcgtgccacggaagat
gaagccgcgatcgctcgccgcctcttacaggctcaaacggaaatcggtgcggccaaagag
tttgatcgctgcgtaatcaatgaccaactagacaccgcgatcaccgccctagaagcggcc
atttttagttag

DBGET integrated database retrieval system