KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1191Help
Entry
Synpcc7942_1191   CDS       T00300                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Synpcc7942_1191 (gmk)
Enzymes [BR:syf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Synpcc7942_1191 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1220349..1220900
Genome map
AA seq 183 aa AA seqDB search
MSIGRVVVLTGPSGVGKGTLLKAILSQHPEAFLSISATTRSPRPGEVDGQHYYFLSREEF
QTKIAEQEFLEWAEFAGNLYGTPRSPVIEQVNLGRTVILEIELEGARQVRKTLPSARQVM
LLPPSVEELERRIRERATEDEAAIARRLLQAQTEIGAAKEFDRCVINDQLDTAITALEAA
IFS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagtattggtcgtgtggtggtgttaacgggacctagtggtgtgggcaaaggcacgctc
ttgaaagcgatcttgtctcagcatcccgaggcctttctttccatctccgccaccacgcga
tcgccccgtccgggcgaagtcgacggtcagcattactacttcctcagtcgcgaggaattt
cagaccaaaattgctgaacaagaatttttagagtgggctgaatttgctggcaacctctac
ggcacaccgcgatcgccggtgattgagcaggtcaacctggggcgcaccgtcatcctcgaa
attgagctagaaggggctcgccaagtcaggaaaacgctcccctcagctcggcaggtgatg
ttgctgccacccagtgttgaggagctggagcgacggattcgggagcgtgccacggaagat
gaagccgcgatcgctcgccgcctcttacaggctcaaacggaaatcggtgcggccaaagag
tttgatcgctgcgtaatcaatgaccaactagacaccgcgatcaccgccctagaagcggcc
atttttagttag

DBGET integrated database retrieval system